TB8.4 Resolved · medium auto-curated
H37Rv Rv1174c · MTBC0 mtbc0_001263 ·
110 aa · 1314110–1314442 (-) ·
RefSeq NP_215690.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | low molecular weight T-cell antigen |
|---|---|
| MTBC0 PGAP re-annotation | hemophore-related protein |
| Revised (this work) | Hemophore-related protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O50430
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Low molecular weight T-cell antigen TB8.4 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Preferred name | TB8.4 |
|---|---|
| Orthologous group | 2BHFX |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadH (NADPH dependent 2,4-dienoyl-CoA reductase FadH), medium confidence from genomic context alone (score 554 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1175c fadH |
NADPH dependent 2,4-dienoyl-CoA reductase FadH | 554 | 554 ctx | neighborhood:552 |
Rv1176c hyp |
hypothetical protein | 517 | 517 ctx | neighborhood:515 |
Rv3875 esxA |
ESAT-6 protein EsxA | 670 | 85 | textmining:655 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 718 | 83 | textmining:706 |
Rv0288 esxH |
ESAT-6-like protein EsxH | 774 | 80 | textmining:765 |
Rv1196 PPE18 |
PPE family protein PPE18 | 450 | 68 | textmining:435 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 526 | 55 | textmining:519 |
Rv3873 PPE68 |
PPE family protein PPE68 | 521 | 54 | textmining:515 |
Rv3615c espC |
ESX-1 secretion-associated protein EspC | 637 | 53 | textmining:633 |
Rv1886c fbpB |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 550 | 47 | textmining:548 |
Rv2875 mpt70 |
major secreted immunogenic protein Mpt70 | 556 | 46 | textmining:554 |
Rv3165c hyp |
hypothetical protein | 630 | 41 | textmining:630 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: low molecular weight T-cell antigen
- MTBC0 PGAP product: hemophore-related protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215690.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BHFX - Curated reference: UniProt O50430 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
fadH - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001263|Rv1174c|TB8.4 MRLSLTALSAGVGAVAMSLTVGAGVASADPVDAVINTTCNYGQVVAALNATDPGAAAQFNASPVAQSYLRNFLAAPPPQRAAMAAQLQAVPGAAQYIGLVESVAGSCNNY