lipX Resolved · high auto-curated
H37Rv Rv1169c · MTBC0 - ·
100 aa · 1299822–1300124 (-) ·
RefSeq YP_177792.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipase LipX |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Lipase LipX. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FR5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Esterase PE11 |
| EC (curated) |
EC 3.1.1.6
|
| Curated function | Involved in cell wall lipids remodeling and in virulence. Restricts the biofilm growth and is essential for the optimal intracellular survival of M.tuberculosis. Shows esterase activity with a preference for short-chain esters, particularly pNP-acetate (C2) and pNP-butyrate (C4). Has weaker activity with pNP-octanoate (C8), pNP-laurate (C12) and pNP-myristate (C14). Shows weak long-chain triacylglycerol (TAG) hydrolase activity in vitro. Not necessary for PPE17 stability or for its localization on the mycobacterial surface. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversionO Post-translational modification, protein turnover, chaperones
|
|---|---|
| eggNOG description | amine dehydrogenase activity |
| Orthologous group | COG3391 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 9.7e-22 | 4–94 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE17 (PPE family protein PPE17), high confidence from genomic context alone (score 762 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1168c PPE17 |
PPE family protein PPE17 | 914 | 762 ctx | neighborhood:762 textmining:656 |
Rv1167c |
transcriptional regulator | 592 | 592 ctx | neighborhood:592 |
Rv1170 mshB |
1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase | 662 | 523 ctx | neighborhood:523 |
Rv0774c hyp |
hypothetical protein | 668 | 41 | textmining:668 |
Rv0963c hyp |
hypothetical protein | 654 | 41 | textmining:654 |
Rv3487c lipF |
carboxylesterase LipF | 621 | 41 | textmining:622 |
Rv1400c lipI |
lipase | 592 | 41 | textmining:592 |
Rv1399c nlhH |
carboxylesterase NlhH | 592 | 41 | textmining:592 |
Rv1900c lipJ |
lignin peroxidase LipJ | 590 | 41 | textmining:590 |
Rv3203 lipV |
lipase LipV | 590 | 41 | textmining:590 |
Rv2430c PPE41 |
PPE family protein PPE41 | 567 | 41 | textmining:568 |
Rv0978c PE_PGRS17 |
PE-PGRS family protein PE_PGRS17 | 542 | 41 | textmining:542 |
Rv2431c PE25 |
PE family protein PE25 | 540 | 41 | textmining:540 |
Rv0755c PPE12 |
PPE family protein PPE12 | 510 | 41 | textmining:510 |
Rv0646c lipG |
lipase/esterase LipG | 456 | 41 | textmining:457 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): lipase LipX
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177792.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3391 - Curated reference: UniProt Q79FR5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
18 functional partner(s); context anchor
PPE17 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1169c|lipX MSFVTTRPDSIGETAANLHEIGVTMSAHDDGVTPLITNVESPAHDLVSIVTSMLFSMHGELYKAIARQAHVIHESFVQTLQTSKTSYWLTELANRAGTST