lipX Resolved · high auto-curated

H37Rv Rv1169c · MTBC0 - · 100 aa · 1299822–1300124 (-) · RefSeq YP_177792.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipase LipX
MTBC0 PGAP re-annotation
Revised (this work)Lipase LipX. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FR5 SwissProt · reviewed · Evidence at protein level
UniProt nameEsterase PE11
EC (curated) EC 3.1.1.6
Curated functionInvolved in cell wall lipids remodeling and in virulence. Restricts the biofilm growth and is essential for the optimal intracellular survival of M.tuberculosis. Shows esterase activity with a preference for short-chain esters, particularly pNP-acetate (C2) and pNP-butyrate (C4). Has weaker activity with pNP-octanoate (C8), pNP-laurate (C12) and pNP-myristate (C14). Shows weak long-chain triacylglycerol (TAG) hydrolase activity in vitro. Not necessary for PPE17 stability or for its localization on the mycobacterial surface.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
O Post-translational modification, protein turnover, chaperones
eggNOG descriptionamine dehydrogenase activity
Orthologous groupCOG3391

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 9.7e-224–94 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE17 (PPE family protein PPE17), high confidence from genomic context alone (score 762 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1168c PPE17 PPE family protein PPE17 914 762 ctx neighborhood:762 textmining:656
Rv1167c transcriptional regulator 592 592 ctx neighborhood:592
Rv1170 mshB 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 662 523 ctx neighborhood:523
Rv0774c hyp hypothetical protein 668 41 textmining:668
Rv0963c hyp hypothetical protein 654 41 textmining:654
Rv3487c lipF carboxylesterase LipF 621 41 textmining:622
Rv1400c lipI lipase 592 41 textmining:592
Rv1399c nlhH carboxylesterase NlhH 592 41 textmining:592
Rv1900c lipJ lignin peroxidase LipJ 590 41 textmining:590
Rv3203 lipV lipase LipV 590 41 textmining:590
Rv2430c PPE41 PPE family protein PPE41 567 41 textmining:568
Rv0978c PE_PGRS17 PE-PGRS family protein PE_PGRS17 542 41 textmining:542
Rv2431c PE25 PE family protein PE25 540 41 textmining:540
Rv0755c PPE12 PPE family protein PPE12 510 41 textmining:510
Rv0646c lipG lipase/esterase LipG 456 41 textmining:457

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): lipase LipX
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177792.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3391
  • Curated reference: UniProt Q79FR5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor PPE17
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1169c|lipX
MSFVTTRPDSIGETAANLHEIGVTMSAHDDGVTPLITNVESPAHDLVSIVTSMLFSMHGELYKAIARQAHVIHESFVQTLQTSKTSYWLTELANRAGTST