Rv0942 Still unknown · low auto-curated

H37Rv Rv0942 · MTBC0 mtbc0_001000 · 92 aa · 1055577–1055855 (+) · RefSeq NP_215457.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF8092. Function unknown. Foldseek best (non-significant) hit: 7va4-assembly1_D Telomeric tetranucleosome in open state (prob 0.06, TM 0.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKN9 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0942

UniProt still lists this protein as Uncharacterized protein Rv0942; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.011 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF8092PF26357.1 1.8e-4010–63 Domain of unknown function (DUF8092)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 38.8 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7va4-assembly1_D 0.06 0.28 2.8e+00 7va4-assembly1_D Telomeric tetranucleosome in open state

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0940c (oxidoreductase), medium confidence from genomic context alone (score 416 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0941c hyp hypothetical protein 572 572 ctx neighborhood:571
Rv0940c oxidoreductase 417 416 ctx neighborhood:414
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 543 47 textmining:541
Rv0887c hyp hypothetical protein 808 44 textmining:808
Rv0911 hyp hypothetical protein 804 44 textmining:804
Rv1731 gabD2 succinate-semialdehyde dehydrogenase 657 44 textmining:656
Rv0912 transmembrane protein 809 42 textmining:809
Rv0234c gabD1 succinate-semialdehyde dehydrogenase 801 42 textmining:801
Rv0181c hyp hypothetical protein 810 41 textmining:810
Rv0180c transmembrane protein 752 41 textmining:752
Rv2009 vapB15 antitoxin VapB15 656 41 textmining:656
Rv0183 lysophospholipase 654 41 textmining:654
Rv2010 vapC15 ribonuclease VapC15 640 41 textmining:640
Rv0654 carotenoid cleavage oxygenase 511 41 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF8092 PF26357.1 (E=2e-40)
  • Foldseek best: 7va4-assembly1_D Telomeric tetranucleosome in open state (prob 0.06, E=3e+00, TM=0.28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215457.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF8092 (PF26357.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WKN9 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 38.8, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv0940c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001000|Rv0942|
MGRSATIAMVPKRRDAMNRHSGPILSSGFIASSSNSCPANSLRMPSALAAETLSFDDRAVRRSTHHPGGGYPQKHAINLQSGLCPAYANASR