TB27.3 Family assigned · medium auto-curated

H37Rv Rv0577 · MTBC0 mtbc0_000607 · 261 aa · 674717–675502 (+) · RefSeq NP_215091.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationVOC family protein
Revised (this work)VOC family protein. Pfam: Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIR3 SwissProt · reviewed · Evidence at protein level
UniProt namePutative glyoxylase CFP32
Curated functionMay function as a glyoxylase involved in the methylglyoxal detoxification pathway. Induces maturation of dendritic cells in a TLR2-dependent manner, causing increased expression of cell-surface molecules (CD80, CD86, MHC class I and II) and pro-inflammatory cytokines (TNF, IL-6, IL-1 beta and IL-12p70). Acts via both the NF-kappa-B and MAPK signaling pathways. Induces Th1-polarized immune responses.

UniProt still lists this protein as Putative glyoxylase CFP32; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionglyoxalase bleomycin resistance protein dioxygenase
Orthologous groupCOG3324
KEGG orthology K06996
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.895 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 2.23% of strains (3240) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlyoxalasePF00903.32 5.4e-1713–124 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Glyoxalase_6PF18029.8 6.5e-09152–254 Glyoxalase-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0576 (transcriptional regulator), high confidence from genomic context alone (score 767 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0576 transcriptional regulator 767 767 ctx neighborhood:755
Rv0575c oxidoreductase 554 544 ctx neighborhood:539
Rv0887c hyp hypothetical protein 653 322 textmining:510
Rv0911 hyp hypothetical protein 406 246
Rv3369 hyp hypothetical protein 510 173 textmining:433
Rv3349c transposase 674 156 textmining:630
Rv1191 hyp hypothetical protein 463 91 textmining:434
Rv1636 TB15.3 iron-regulated universal stress protein 419 55 textmining:411
Rv0831c hyp hypothetical protein 444 52 textmining:438
Rv1510 hyp hypothetical protein 810 50 textmining:809
Rv3044 fecB FeIII-dicitrate-binding periplasmic lipoprotein 771 50 textmining:769
Rv0652 rplL 50S ribosomal protein L7/L12 416 50 textmining:411
Rv2298 oxidoreductase 804 47 textmining:803
Rv3877 eccD1 ESX-1 secretion system protein EccD1 514 47 textmining:511
Rv3248c sahH adenosylhomocysteinase 438 47 textmining:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: VOC family protein
  • Pfam (hmmscan --cut_ga): Glyoxalase PF00903.32 (E=5e-17), Glyoxalase_6 PF18029.8 (E=7e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215091.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3324
  • Curated reference: UniProt P9WIR3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv0576
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000607|Rv0577|TB27.3
MPKRSEYRQGTPNWVDLQTTDQSAAKKFYTSLFGWGYDDNPVPGGGGVYSMATLNGEAVAAIAPMPPGAPEGMPPIWNTYIAVDDVDAVVDKVVPGGGQVMMPAFDIGDAGRMSFITDPTGAAVGLWQANRHIGATLVNETGTLIWNELLTDKPDLALAFYEAVVGLTHSSMEIAAGQNYRVLKAGDAEVGGCMEPPMPGVPNHWHVYFAVDDADATAAKAAAAGGQVIAEPADIPSVGRFAVLSDPQGAIFSVLKPAPQQ