fadA Resolved · high auto-curated

H37Rv Rv0859 · MTBC0 mtbc0_000914 · 403 aa · 958227–959438 MTBC0 (+) · RefSeq NP_215374.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyltransferase
MTBC0 PGAP re-annotationacetyl-CoA C-acetyltransferase
Revised (this work)Acetyl-CoA C-acetyltransferase. Pfam: Thiolase_N (PF00108.30), ketoacyl-synt (PF00109.33), Thiolase_C (PF02803.25).
Functional category (TubercuList)lipid metabolism

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 6 publications

6 TB publications mention this gene. 6 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — ).

Most recent 5 of 6.
PublicationDate
Biodegradation of Di-2-Ethylhexyl Phthalate by Mangrove Sediment Microbiome Impacted by Chronic Plastic Waste. doi:10.1007/s10126-024-10399-5 2024
Improved sea rice yield and accelerated di-2-ethylhexyl phthalate (DEHP) degradation by straw carbonization returning in coastal saline soils. doi:10.1016/j.jhazmat.2023.132850 2023
Interception of host fatty acid metabolism by mycobacteria under hypoxia to suppress anti-TB immunity. doi:10.1038/s41421-021-00301-1 2021
Crystal structure of Mycobacterium tuberculosis FadB2 implicated in mycobacterial β-oxidation. doi:10.1107/S2059798318017242 2019
Comparative genomic analysis of Mycobacterium neoaurum MN2 and MN4 substrate and product tolerance. doi:10.1007/s13205-017-0818-2 2017

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): FasR (fasR).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.76 (95% CI -0.99 to 3.65). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown, but involvement in lipid degradation.
Mycobrowser EC 2.3.1.- · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0882 · 99.8% identity
M. leprae ML2162c · 94.5% identity
M. marinum MMAR_4677 · 93.8% identity
M. smegmatis MSMEG_5721 · 85.6% identity
M. orygis RJtmp_000909 · 99.8% identity
M. abscessus MAB_0850 · 86.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53871 SwissProt · reviewed · Evidence at protein level
UniProt namePutative acyltransferase Rv0859
EC (curated) EC 2.3.1.-

UniProt still lists this protein as Putative acyltransferase Rv0859; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namefadA
eggNOG descriptionCatalyzes the synthesis of acetoacetyl coenzyme A from two molecules of acetyl coenzyme A. It can also act as a thiolase, catalyzing the reverse reaction and generating two-carbon units from the four-carbon product of fatty acid oxidation
Orthologous groupCOG0183
EC number EC 2.3.1.9
KEGG orthology K00626
KEGG pathways map00071, map00072, map00280, map00310, map00362, map00380, map00620, map00630, map00640, map00650, map00720, map00900, map01100, map01110, map01120, map01130, map01200, map01212, map02020
KEGG modules M00088, M00095, M00373, M00374, M00375
Gene Ontology (44) GO:0003674, GO:0003824, GO:0003988, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006635, GO:0008150 +32 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.338 · purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.169 (low power) · 6 consensus substitution(s)
low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 92.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.0%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 58.4444444444. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness after prolonged in vitro passage (in vitro passage) -8.990.017 required
fitness in mouse infection (in vivo) +6.600.04 disruption advantageous
fitness in mouse infection, day 45 (in vivo) -4.790.024 required
altered fitness under Isoniazid (drug exposure) +2.060.0 disruption advantageous
altered fitness under Isoniazid (drug exposure) +1.420.0094 disruption advantageous

Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance997.0 ppm · rank 229/3519 (93.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length403 aa
Molecular weight42.4 kDa
Theoretical pI5.2
GRAVY0.036 (hydrophobic)
Aliphatic index97.6
Aromaticity0.045
Instability index30.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thiolase_NPF00108.30 3.3e-466–226 Thiolase, N-terminal domain
ketoacyl-syntPF00109.33 6.6e-0592–123 Beta-ketoacyl synthase, N-terminal domain
Thiolase_CPF02803.25 2.8e-47281–402 Thiolase, C-terminal domain

Experimental structures (Protein Data Bank) 31 solved

PDBMethodResolutionCoverage
7o4q X-ray diffraction 2.1 Å 100%
7o4t X-ray diffraction 2.1 Å 100%
8oqp X-ray diffraction 2.18 Å 100%
8oqn X-ray diffraction 2.2 Å 100%
8pf8 X-ray diffraction 2.23 Å 100%
4b3h X-ray diffraction 2.3 Å 100%
7o1i X-ray diffraction 2.3 Å 100%
8oqs X-ray diffraction 2.33 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (31 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.3

PDB hitprobTM-scoreE-valueDescription
4b3j-assembly1_C 1.00 1.00 8.2e-84 sig 4b3j-assembly1_C Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase and thiolase active sites
7o1l-assembly1_D-2 1.00 1.00 5.1e-83 sig 7o1l-assembly1_D-2 Structure of Mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-H462A mutant
4b3j-assembly1_D 1.00 0.99 1.6e-82 sig 4b3j-assembly1_D Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase and thiolase active sites
8oqu-assembly1_C 1.00 1.00 5.3e-82 sig 8oqu-assembly1_C Structure of Mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with Fragment-M-92
8opx-assembly1_C 1.00 1.00 4.6e-82 sig 8opx-assembly1_C Structure of Mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with Trehalose (Fragment-B-TRE)

Foldseek search of the AlphaFold DB model (mean pLDDT 97.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)dapC (- strand, 156 bp gap)
Downstream (3' on genome)fadB (+ strand, 4 bp gap)
Predicted operon Rv0859 · fadB

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) Rv0324 (represses) · Rv1985c (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: fadB (fatty oxidation protein FadB), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0860 fadB exp fatty oxidation protein FadB 999 1000 ctx neighborhood:882 cooccurence:730 coexpression:955 experimental:980 database:942 textmining:949
Rv0468 fadB2 exp 3-hydroxybutyryl-CoA dehydrogenase 989 982 ctx cooccurence:411 coexpression:429 experimental:412 database:900 textmining:458
Rv1715 fadB3 exp 3-hydroxybutyryl-CoA dehydrogenase FadB 984 977 coexpression:426 experimental:412 database:900
Rv3667 acs exp acetyl-CoAsynthetase 953 941 coexpression:413 database:900
Rv1837c glcB exp malate synthase 927 924 database:900
Rv0243 fadA2 exp acetyl-CoA acetyltransferase FadA 924 924 database:900
Rv2503c scoB exp succinyl-CoA:3-ketoacid-CoA transferase subunit B 932 923 database:900
Rv1323 fadA4 exp acetyl-CoA acetyltransferase 928 923 database:900
Rv3710 leuA exp 2-isopropylmalate synthase 925 923 database:900
Rv2504c scoA exp succinyl-CoA:3-ketoacid-CoA transferase subunit A 926 922 database:900
Rv1074c fadA3 exp beta-ketoacyl CoA thiolase FadA 919 915 database:900
Rv3546 fadA5 exp acetyl-CoA acetyltransferase FadA 913 914 database:900
Rv3556c fadA6 exp acetyl-CoA acetyltransferase FadA 914 913 database:900
Rv0753c mmsA exp methylmalonate-semialdehyde dehydrogenase 914 911 database:900
Rv0408 pta exp phosphate acetyltransferase 931 906 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyltransferase
  • MTBC0 PGAP product: acetyl-CoA C-acetyltransferase
  • Pfam (hmmscan --cut_ga): Thiolase_N PF00108.30 (E=3e-46), ketoacyl-synt PF00109.33 (E=7e-05), Thiolase_C PF02803.25 (E=3e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215374.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thiolase_N (PF00108.30), ketoacyl-synt (PF00109.33), Thiolase_C (PF02803.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0183
  • Curated reference: UniProt O53871 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 127 functional partner(s); context anchor fadB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000914|Rv0859|fadA
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVSPVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAEAWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQKYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIMLTGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHPLGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV