fadA Resolved · high auto-curated
H37Rv Rv0859 · MTBC0 mtbc0_000914 ·
403 aa ·
958227–959438 MTBC0
(+) ·
RefSeq NP_215374.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | acetyl-CoA C-acetyltransferase |
| Revised (this work) | Acetyl-CoA C-acetyltransferase. Pfam: Thiolase_N (PF00108.30), ketoacyl-synt (PF00109.33), Thiolase_C (PF02803.25). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — ).
| Publication | Date |
|---|---|
| Biodegradation of Di-2-Ethylhexyl Phthalate by Mangrove Sediment Microbiome Impacted by Chronic Plastic Waste. doi:10.1007/s10126-024-10399-5 | 2024 |
| Improved sea rice yield and accelerated di-2-ethylhexyl phthalate (DEHP) degradation by straw carbonization returning in coastal saline soils. doi:10.1016/j.jhazmat.2023.132850 | 2023 |
| Interception of host fatty acid metabolism by mycobacteria under hypoxia to suppress anti-TB immunity. doi:10.1038/s41421-021-00301-1 | 2021 |
| Crystal structure of Mycobacterium tuberculosis FadB2 implicated in mycobacterial β-oxidation. doi:10.1107/S2059798318017242 | 2019 |
| Comparative genomic analysis of Mycobacterium neoaurum MN2 and MN4 substrate and product tolerance. doi:10.1007/s13205-017-0818-2 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
FasR (fasR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.76 (95% CI -0.99 to 3.65). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown, but involvement in lipid degradation. |
|---|---|
| Mycobrowser EC |
2.3.1.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0882
· 99.8% identity |
|---|---|
| M. leprae |
ML2162c
· 94.5% identity |
| M. marinum |
MMAR_4677
· 93.8% identity |
| M. smegmatis |
MSMEG_5721
· 85.6% identity |
| M. orygis |
RJtmp_000909
· 99.8% identity |
| M. abscessus |
MAB_0850
· 86.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53871
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative acyltransferase Rv0859 |
| EC (curated) |
EC 2.3.1.-
|
UniProt still lists this protein as Putative acyltransferase Rv0859; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | fadA |
| eggNOG description | Catalyzes the synthesis of acetoacetyl coenzyme A from two molecules of acetyl coenzyme A. It can also act as a thiolase, catalyzing the reverse reaction and generating two-carbon units from the four-carbon product of fatty acid oxidation |
| Orthologous group | COG0183 |
| EC number |
EC 2.3.1.9
|
| KEGG orthology |
K00626
|
| KEGG pathways |
map00071, map00072, map00280, map00310, map00362, map00380, map00620, map00630, map00640, map00650, map00720, map00900, map01100, map01110, map01120, map01130, map01200, map01212, map02020
|
| KEGG modules |
M00088, M00095, M00373, M00374, M00375
|
| Gene Ontology (44) |
GO:0003674, GO:0003824, GO:0003988, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006635, GO:0008150 +32 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.338 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 9 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.169 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 92.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 58.4444444444. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -8.99 | 0.017 | required |
| fitness in mouse infection (in vivo) | +6.60 | 0.04 | disruption advantageous |
| fitness in mouse infection, day 45 (in vivo) | -4.79 | 0.024 | required |
| altered fitness under Isoniazid (drug exposure) | +2.06 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +1.42 | 0.0094 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 997.0 ppm · rank 229/3519 (93.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 403 aa |
|---|---|
| Molecular weight | 42.4 kDa |
| Theoretical pI | 5.2 |
| GRAVY | 0.036 (hydrophobic) |
| Aliphatic index | 97.6 |
| Aromaticity | 0.045 |
| Instability index | 30.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Thiolase_N | PF00108.30 | 3.3e-46 | 6–226 | Thiolase, N-terminal domain |
ketoacyl-synt | PF00109.33 | 6.6e-05 | 92–123 | Beta-ketoacyl synthase, N-terminal domain |
Thiolase_C | PF02803.25 | 2.8e-47 | 281–402 | Thiolase, C-terminal domain |
Experimental structures (Protein Data Bank) 31 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7o4q |
X-ray diffraction | 2.1 Å | 100% |
7o4t |
X-ray diffraction | 2.1 Å | 100% |
8oqp |
X-ray diffraction | 2.18 Å | 100% |
8oqn |
X-ray diffraction | 2.2 Å | 100% |
8pf8 |
X-ray diffraction | 2.23 Å | 100% |
4b3h |
X-ray diffraction | 2.3 Å | 100% |
7o1i |
X-ray diffraction | 2.3 Å | 100% |
8oqs |
X-ray diffraction | 2.33 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (31 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4b3j-assembly1_C |
1.00 | 1.00 | 8.2e-84 sig | 4b3j-assembly1_C Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase and thiolase active sites |
7o1l-assembly1_D-2 |
1.00 | 1.00 | 5.1e-83 sig | 7o1l-assembly1_D-2 Structure of Mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-H462A mutant |
4b3j-assembly1_D |
1.00 | 0.99 | 1.6e-82 sig | 4b3j-assembly1_D Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase and thiolase active sites |
8oqu-assembly1_C |
1.00 | 1.00 | 5.3e-82 sig | 8oqu-assembly1_C Structure of Mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with Fragment-M-92 |
8opx-assembly1_C |
1.00 | 1.00 | 4.6e-82 sig | 8opx-assembly1_C Structure of Mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with Trehalose (Fragment-B-TRE) |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | dapC (- strand, 156 bp gap) |
|---|---|
| Downstream (3' on genome) | fadB (+ strand, 4 bp gap) |
| Predicted operon |
Rv0859 · fadB
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv0324 (represses) · Rv1985c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: fadB (fatty oxidation protein FadB), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0860 fadB exp |
fatty oxidation protein FadB | 999 | 1000 ctx | neighborhood:882 cooccurence:730 coexpression:955 experimental:980 database:942 textmining:949 |
Rv0468 fadB2 exp |
3-hydroxybutyryl-CoA dehydrogenase | 989 | 982 ctx | cooccurence:411 coexpression:429 experimental:412 database:900 textmining:458 |
Rv1715 fadB3 exp |
3-hydroxybutyryl-CoA dehydrogenase FadB | 984 | 977 | coexpression:426 experimental:412 database:900 |
Rv3667 acs exp |
acetyl-CoAsynthetase | 953 | 941 | coexpression:413 database:900 |
Rv1837c glcB exp |
malate synthase | 927 | 924 | database:900 |
Rv0243 fadA2 exp |
acetyl-CoA acetyltransferase FadA | 924 | 924 | database:900 |
Rv2503c scoB exp |
succinyl-CoA:3-ketoacid-CoA transferase subunit B | 932 | 923 | database:900 |
Rv1323 fadA4 exp |
acetyl-CoA acetyltransferase | 928 | 923 | database:900 |
Rv3710 leuA exp |
2-isopropylmalate synthase | 925 | 923 | database:900 |
Rv2504c scoA exp |
succinyl-CoA:3-ketoacid-CoA transferase subunit A | 926 | 922 | database:900 |
Rv1074c fadA3 exp |
beta-ketoacyl CoA thiolase FadA | 919 | 915 | database:900 |
Rv3546 fadA5 exp |
acetyl-CoA acetyltransferase FadA | 913 | 914 | database:900 |
Rv3556c fadA6 exp |
acetyl-CoA acetyltransferase FadA | 914 | 913 | database:900 |
Rv0753c mmsA exp |
methylmalonate-semialdehyde dehydrogenase | 914 | 911 | database:900 |
Rv0408 pta exp |
phosphate acetyltransferase | 931 | 906 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acyltransferase
- MTBC0 PGAP product: acetyl-CoA C-acetyltransferase
- Pfam (hmmscan --cut_ga): Thiolase_N PF00108.30 (E=3e-46), ketoacyl-synt PF00109.33 (E=7e-05), Thiolase_C PF02803.25 (E=3e-47)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215374.1)
- Domains: Pfam-A via hmmscan --cut_ga — Thiolase_N (PF00108.30), ketoacyl-synt (PF00109.33), Thiolase_C (PF02803.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0183 - Curated reference: UniProt O53871 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
127 functional partner(s); context anchor
fadB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000914|Rv0859|fadA MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVSPVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAEAWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQKYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIMLTGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHPLGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for fadA? Email the maintainer — the message is pre-filled with this gene's details.