fadA Resolved · high auto-curated

H37Rv Rv0859 · MTBC0 mtbc0_000914 · 403 aa · 958227–959438 (+) · RefSeq NP_215374.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyltransferase
MTBC0 PGAP re-annotationacetyl-CoA C-acetyltransferase
Revised (this work)Acetyl-CoA C-acetyltransferase. Pfam: Thiolase_N (PF00108.30), ketoacyl-synt (PF00109.33), Thiolase_C (PF02803.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53871 SwissProt · reviewed · Evidence at protein level
UniProt namePutative acyltransferase Rv0859
EC (curated) EC 2.3.1.-

UniProt still lists this protein as Putative acyltransferase Rv0859; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namefadA
eggNOG descriptionCatalyzes the synthesis of acetoacetyl coenzyme A from two molecules of acetyl coenzyme A. It can also act as a thiolase, catalyzing the reverse reaction and generating two-carbon units from the four-carbon product of fatty acid oxidation
Orthologous groupCOG0183
EC number EC 2.3.1.9
KEGG orthology K00626
KEGG pathways map00071, map00072, map00280, map00310, map00362, map00380, map00620, map00630, map00640, map00650, map00720, map00900, map01100, map01110, map01120, map01130, map01200, map01212, map02020
KEGG modules M00088, M00095, M00373, M00374, M00375
Gene Ontology (44) GO:0003674, GO:0003824, GO:0003988, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006635, GO:0008150 +32 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.338 · purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thiolase_NPF00108.30 3.3e-466–226 Thiolase, N-terminal domain
ketoacyl-syntPF00109.33 6.6e-0592–123 Beta-ketoacyl synthase, N-terminal domain
Thiolase_CPF02803.25 2.8e-47281–402 Thiolase, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadB (fatty oxidation protein FadB), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0860 fadB fatty oxidation protein FadB 999 1000 ctx neighborhood:882 cooccurence:730 coexpression:955 experimental:980 database:942 textmining:949
Rv0468 fadB2 3-hydroxybutyryl-CoA dehydrogenase 989 982 ctx cooccurence:411 coexpression:429 experimental:412 database:900 textmining:458
Rv1715 fadB3 3-hydroxybutyryl-CoA dehydrogenase FadB 984 977 coexpression:426 experimental:412 database:900
Rv3667 acs acetyl-CoAsynthetase 953 941 coexpression:413 database:900
Rv1837c glcB malate synthase 927 924 database:900
Rv0243 fadA2 acetyl-CoA acetyltransferase FadA 924 924 database:900
Rv2503c scoB succinyl-CoA:3-ketoacid-CoA transferase subunit B 932 923 database:900
Rv1323 fadA4 acetyl-CoA acetyltransferase 928 923 database:900
Rv3710 leuA 2-isopropylmalate synthase 925 923 database:900
Rv2504c scoA succinyl-CoA:3-ketoacid-CoA transferase subunit A 926 922 database:900
Rv1074c fadA3 beta-ketoacyl CoA thiolase FadA 919 915 database:900
Rv3546 fadA5 acetyl-CoA acetyltransferase FadA 913 914 database:900
Rv3556c fadA6 acetyl-CoA acetyltransferase FadA 914 913 database:900
Rv0753c mmsA methylmalonate-semialdehyde dehydrogenase 914 911 database:900
Rv0408 pta phosphate acetyltransferase 931 906 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyltransferase
  • MTBC0 PGAP product: acetyl-CoA C-acetyltransferase
  • Pfam (hmmscan --cut_ga): Thiolase_N PF00108.30 (E=3e-46), ketoacyl-synt PF00109.33 (E=7e-05), Thiolase_C PF02803.25 (E=3e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215374.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thiolase_N (PF00108.30), ketoacyl-synt (PF00109.33), Thiolase_C (PF02803.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0183
  • Curated reference: UniProt O53871 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 127 functional partner(s); context anchor fadB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000914|Rv0859|fadA
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVSPVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAEAWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQKYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIMLTGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHPLGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV