Rv0763c Resolved · high auto-curated

H37Rv Rv0763c · MTBC0 mtbc0_000812 · 68 aa · 860897–861103 (-) · RefSeq NP_215277.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ferredoxin
MTBC0 PGAP re-annotationferredoxin
Revised (this work)Ferredoxin. Pfam: Fer4_19 (PF06902.17), Fer4_15 (PF13459.12), Fer4_13 (PF13370.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71820 SwissProt · reviewed · Evidence at protein level
UniProt nameFerredoxin Fdx
Curated functionFerredoxin that is the redox partner of cytochrome CYP51, a sterol 14alpha-demethylase encoded by an adjacent gene.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionferredoxin
Orthologous groupCOG1141

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.158 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fer4_19PF06902.17 4.6e-064–65 Divergent 4Fe-4S mono-cluster
Fer4_15PF13459.12 1.1e-095–63 4Fe-4S single cluster domain
Fer4_13PF13370.12 2.7e-068–61 4Fe-4S single cluster domain of Ferredoxin I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp51 (lanosterol 14-alpha demethylase), high confidence from genomic context alone (score 990 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0764c cyp51 lanosterol 14-alpha demethylase 990 990 ctx neighborhood:882 cooccurence:592 coexpression:801
Rv0765c oxidoreductase 979 979 ctx neighborhood:882 cooccurence:482 coexpression:687
Rv0762c hyp hypothetical protein 977 977 ctx neighborhood:882 cooccurence:750
Rv0767c HTH-type transcriptional regulator 959 960 ctx neighborhood:881 cooccurence:666
Rv0766c cyp123 cytochrome P450 Cyp123 931 928 ctx neighborhood:882
Rv0771 4-carboxymuconolactone decarboxylase 860 861 ctx neighborhood:677 cooccurence:528
Rv0770 oxidoreductase 849 850 ctx neighborhood:677 coexpression:449
Rv0760c hyp hypothetical protein 832 832 ctx neighborhood:769
Rv0768 aldA aldehyde dehydrogenase AldA 804 805 ctx neighborhood:758
Rv0761c adhB alcohol dehydrogenase B 774 774 ctx neighborhood:774
Rv0769 oxidoreductase 767 767 ctx neighborhood:731
Rv0311 hyp hypothetical protein 714 714 ctx cooccurence:667
Rv3519 hyp hypothetical protein 555 555 ctx cooccurence:541
Rv0772 purD phosphoribosylamine--glycine ligase 500 499 ctx neighborhood:496
Rv0759c hyp hypothetical protein 446 446 ctx neighborhood:443

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ferredoxin
  • MTBC0 PGAP product: ferredoxin
  • Pfam (hmmscan --cut_ga): Fer4_19 PF06902.17 (E=5e-06), Fer4_15 PF13459.12 (E=1e-09), Fer4_13 PF13370.12 (E=3e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215277.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fer4_19 (PF06902.17), Fer4_15 (PF13459.12), Fer4_13 (PF13370.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1141
  • Curated reference: UniProt P71820 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor cyp51
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000812|Rv0763c|
MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE