Rv0763c Resolved · high auto-curated
H37Rv Rv0763c · MTBC0 mtbc0_000812 ·
68 aa · 860897–861103 (-) ·
RefSeq NP_215277.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ferredoxin |
|---|---|
| MTBC0 PGAP re-annotation | ferredoxin |
| Revised (this work) | Ferredoxin. Pfam: Fer4_19 (PF06902.17), Fer4_15 (PF13459.12), Fer4_13 (PF13370.12). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71820
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ferredoxin Fdx |
| Curated function | Ferredoxin that is the redox partner of cytochrome CYP51, a sterol 14alpha-demethylase encoded by an adjacent gene. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | ferredoxin |
| Orthologous group | COG1141 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.158 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fer4_19 | PF06902.17 | 4.6e-06 | 4–65 | Divergent 4Fe-4S mono-cluster |
Fer4_15 | PF13459.12 | 1.1e-09 | 5–63 | 4Fe-4S single cluster domain |
Fer4_13 | PF13370.12 | 2.7e-06 | 8–61 | 4Fe-4S single cluster domain of Ferredoxin I |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cyp51 (lanosterol 14-alpha demethylase), high confidence from genomic context alone (score 990 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0764c cyp51 |
lanosterol 14-alpha demethylase | 990 | 990 ctx | neighborhood:882 cooccurence:592 coexpression:801 |
Rv0765c |
oxidoreductase | 979 | 979 ctx | neighborhood:882 cooccurence:482 coexpression:687 |
Rv0762c hyp |
hypothetical protein | 977 | 977 ctx | neighborhood:882 cooccurence:750 |
Rv0767c |
HTH-type transcriptional regulator | 959 | 960 ctx | neighborhood:881 cooccurence:666 |
Rv0766c cyp123 |
cytochrome P450 Cyp123 | 931 | 928 ctx | neighborhood:882 |
Rv0771 |
4-carboxymuconolactone decarboxylase | 860 | 861 ctx | neighborhood:677 cooccurence:528 |
Rv0770 |
oxidoreductase | 849 | 850 ctx | neighborhood:677 coexpression:449 |
Rv0760c hyp |
hypothetical protein | 832 | 832 ctx | neighborhood:769 |
Rv0768 aldA |
aldehyde dehydrogenase AldA | 804 | 805 ctx | neighborhood:758 |
Rv0761c adhB |
alcohol dehydrogenase B | 774 | 774 ctx | neighborhood:774 |
Rv0769 |
oxidoreductase | 767 | 767 ctx | neighborhood:731 |
Rv0311 hyp |
hypothetical protein | 714 | 714 ctx | cooccurence:667 |
Rv3519 hyp |
hypothetical protein | 555 | 555 ctx | cooccurence:541 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 500 | 499 ctx | neighborhood:496 |
Rv0759c hyp |
hypothetical protein | 446 | 446 ctx | neighborhood:443 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ferredoxin
- MTBC0 PGAP product: ferredoxin
- Pfam (hmmscan --cut_ga): Fer4_19 PF06902.17 (E=5e-06), Fer4_15 PF13459.12 (E=1e-09), Fer4_13 PF13370.12 (E=3e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215277.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fer4_19 (PF06902.17), Fer4_15 (PF13459.12), Fer4_13 (PF13370.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1141 - Curated reference: UniProt P71820 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
cyp51 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000812|Rv0763c| MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE