Rv0759c Family assigned · medium auto-curated
H37Rv Rv0759c · MTBC0 - ·
110 aa · 853825–854157 (-) ·
RefSeq NP_215273.3
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains HIT (PF01230.30) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WML3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized HIT-like protein Rv0759c |
UniProt still lists this protein as Uncharacterized HIT-like protein Rv0759c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolismG Carbohydrate transport and metabolism
|
|---|---|
| Preferred name | hit |
| eggNOG description | diadenosine tetraphosphate (Ap4A) hydrolase and other hit family hydrolases |
| Orthologous group | COG0537 |
| KEGG orthology |
K02503
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HIT | PF01230.30 | 2.2e-20 | 2–77 | HIT domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: adhB (alcohol dehydrogenase B), medium confidence from genomic context alone (score 563 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1684 hyp |
hypothetical protein | 783 | 783 | coexpression:775 |
Rv0668 rpoC |
DNA-directed RNA polymerase subunit beta' | 656 | 644 | database:592 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 622 | 622 | database:585 |
Rv0667 rpoB |
DNA-directed RNA polymerase subunit beta | 610 | 604 | database:586 |
Rv3457c rpoA |
DNA-directed RNA polymerase subunit alpha | 603 | 603 | database:595 |
Rv3211 rhlE |
ATP-dependent RNA helicase RhlE | 609 | 601 | database:538 |
Rv1253 deaD |
ATP-dependent RNA helicase DeaD | 607 | 600 | database:538 |
Rv0861c ercc3 |
DNA helicase Ercc3 | 595 | 596 | database:543 |
Rv2101 helZ |
helicase HelZ | 573 | 573 | database:563 |
Rv1329c dinG |
ATP-dependent helicase DinG | 566 | 567 | database:563 |
Rv1179c hyp |
hypothetical protein | 565 | 565 | database:543 |
Rv1947 hyp |
hypothetical protein | 564 | 565 | database:543 |
Rv0761c adhB |
alcohol dehydrogenase B | 563 | 563 ctx | neighborhood:530 |
Rv2917 hyp |
hypothetical protein | 562 | 563 | database:543 |
Rv1961 hyp |
hypothetical protein | 561 | 562 | database:543 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): HIT PF01230.30 (E=2e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215273.3)
- Domains: Pfam-A via hmmscan --cut_ga — HIT (PF01230.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0537 - Curated reference: UniProt P9WML3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
43 functional partner(s); context anchor
adhB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0759c| MAFLTIEPMTQGHTLVVPRAEIDHWQNVDPALFGRVMSVSQLIGKAVCRAFSTQRAGMIIAGLEVPHLHIHVFPTRSLSDFGFANVDRNPSPGSLDEAQAKIRAALAQLA