mmsA Resolved · high auto-curated

H37Rv Rv0753c · MTBC0 mtbc0_000800 · 510 aa · 848846–850378 (-) · RefSeq NP_215267.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)methylmalonate-semialdehyde dehydrogenase
MTBC0 PGAP re-annotationCoA-acylating methylmalonate-semialdehyde dehydrogenase
Revised (this work)CoA-acylating methylmalonate-semialdehyde dehydrogenase. Pfam: Aldedh (PF00171.28), LuxC (PF05893.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53816 TrEMBL · unreviewed · Evidence at protein level
UniProt namemethylmalonate-semialdehyde dehydrogenase
EC (curated) EC 1.2.1.27

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namemmsA
eggNOG descriptionDehydrogenase
Orthologous groupCOG1012
EC number EC 1.2.1.18, EC 1.2.1.27
KEGG orthology K00140
KEGG pathways map00280, map00410, map00562, map00640, map01100, map01200
KEGG modules M00013
Gene Ontology (54) GO:0000166, GO:0003674, GO:0003824, GO:0004029, GO:0004030, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005739, GO:0005759 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.374 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AldedhPF00171.28 7.8e-13817–490 Aldehyde dehydrogenase family
LuxCPF05893.20 1.8e-06134–270 Acyl-CoA reductase (LuxC)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmsB (3-hydroxyisobutyrate dehydrogenase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0751c mmsB 3-hydroxyisobutyrate dehydrogenase 998 998 ctx neighborhood:875 cooccurence:426 coexpression:753 database:900
Rv0752c fadE9 acyl-CoA dehydrogenase FadE9 987 987 ctx neighborhood:882 coexpression:875
Rv3667 acs acetyl-CoAsynthetase 950 947 coexpression:419 database:900
Rv2589 gabT 4-aminobutyrate aminotransferase 937 932 database:900
Rv0768 aldA aldehyde dehydrogenase AldA 929 927 database:900
Rv0223c aldehyde dehydrogenase 925 923 database:900
Rv0147 aldehyde dehydrogenase 936 922 database:900
Rv0860 fadB fatty oxidation protein FadB 926 922 database:900
Rv0408 pta phosphate acetyltransferase 926 915 database:900
Rv0914c lipid carrier protein or keto acyl-CoA thiolase 915 911 database:900
Rv0859 fadA acyltransferase 914 911 database:900
Rv1867 hyp hypothetical protein 914 911 database:900
Rv1323 fadA4 acetyl-CoA acetyltransferase 914 911 database:900
Rv3546 fadA5 acetyl-CoA acetyltransferase FadA 928 910 database:900
Rv3523 ltp3 lipid carrier protein 914 910 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: methylmalonate-semialdehyde dehydrogenase
  • MTBC0 PGAP product: CoA-acylating methylmalonate-semialdehyde dehydrogenase
  • Pfam (hmmscan --cut_ga): Aldedh PF00171.28 (E=8e-138), LuxC PF05893.20 (E=2e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215267.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aldedh (PF00171.28), LuxC (PF05893.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1012
  • Curated reference: UniProt O53816 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 78 functional partner(s); context anchor mmsB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000800|Rv0753c|mmsA
MTTQISHFIDGQRTAGQSTRSADVFDPNTGQIQAKVPMAGKSDIDAAVASAVEAQKGWAAWNPQRRARVLMRFIELVNDTIDELAELLSREHGKTLADARGDVQRGIEVIEFCLGIPHLLKGEYTEGAGPGIDVYSLRQPLGVVAGITPFNFPAMIPLWKAGPALACGNAFVLKPSERDPSVPVRLAELFIEAGLPAGVFQVVHGDKEAVDAILHHPDIKAVGFVGSSDIAQYIYAGAAATGKRAQCFGGAKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGDQTAERLRARLIERINNLRVGHSLDPKADYGPLVTGAALARVRDYIGQGVAAGAELVVDGRDRASDDLTFGLPEGDANLEGGFFIGPTLFDHVAAHMSIYTDEIFGPVLCMVRARDYEEALRLPSEHEYGNGVAIFTRDGDAARDFVSRVQVGMVGVNVPIPVPVAYHTFGGWKRSGFGDLNQHGPAAIQFYTKVKTVTSRWPSGIKDGAEFVIPTMS