phoR Resolved · high auto-curated

H37Rv Rv0758 · MTBC0 mtbc0_000807 · 485 aa · 856821–858278 (+) · RefSeq NP_215272.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component system response sensor kinase PhoR
MTBC0 PGAP re-annotationsensory box histidine kinase PhoR
Revised (this work)Sensory box histidine kinase PhoR. Pfam: HAMP (PF00672.31), HisKA (PF00512.32), HATPase_c (PF02518.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71815 TrEMBL · unreviewed · Evidence at protein level
UniProt namehistidine kinase
EC (curated) EC 2.7.13.3

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred namephoR
eggNOG descriptionHistidine kinase
Orthologous groupCOG5002
EC number EC 2.7.13.3
KEGG orthology K02484

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.508 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HAMPPF00672.31 5.3e-11179–230 HAMP domain
HisKAPF00512.32 5.3e-18250–312 His Kinase A (phospho-acceptor) domain
HATPase_cPF02518.32 1.7e-31358–468 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: phoP (two component system response transcriptional positive regulator PhoP), high confidence from genomic context alone (score 975 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0757 phoP two component system response transcriptional positive regulator PhoP 999 975 ctx neighborhood:817 cooccurence:772 textmining:978
Rv3765c tcrX two component transcriptional regulator TcrX 880 859 ctx cooccurence:748
Rv3246c mtrA two component DNA-binding response regulator MtrA 866 855 ctx cooccurence:746
Rv1033c trcR two component transcriptional regulator TrcR 896 853 ctx cooccurence:743
Rv0903c prrA two component transcriptional regulator PrrA 860 853 ctx cooccurence:740
Rv0602c tcrA two component DNA binding transcriptional regulator TcrA 877 852 ctx cooccurence:742
Rv0491 regX3 two component sensory transduction protein RegX 915 849 ctx cooccurence:727 textmining:462
Rv3454 Rv3454, (MTCY13E12.07), len: 422 aa. Probable conserved integral membrane protein, showing some similarity to various proteins (generally tr 836 836 ctx fusion:836
Rv0981 mprA two-component response regulator MrpA 833 825 ctx cooccurence:665
Rv1027c kdpE transcriptional regulator KdpE 784 756 ctx cooccurence:575
Rv0756c hyp hypothetical protein 747 736 ctx neighborhood:733
Rv2884 transcriptional regulator 800 716 ctx cooccurence:500
Rv0818 transcriptional regulator 758 658
Rv0983 pepD serine protease PepD 589 572 coexpression:410
Rv1223 htrA serine protease HtrA 516 495

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: two component system response sensor kinase PhoR
  • MTBC0 PGAP product: sensory box histidine kinase PhoR
  • Pfam (hmmscan --cut_ga): HAMP PF00672.31 (E=5e-11), HisKA PF00512.32 (E=5e-18), HATPase_c PF02518.32 (E=2e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215272.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HAMP (PF00672.31), HisKA (PF00512.32), HATPase_c (PF02518.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5002
  • Curated reference: UniProt P71815 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor phoP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000807|Rv0758|phoR
MARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSRIDRVLLEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNTAIPAVPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADVRSTVRSLVLLQVGIGSAVLVVLGVAGYAVVRRSLRPLAEFEQTAAAIGAGQLDRRVPQWHPRTEVGRLSLALNGMLAQIQRAVASAESSAEKARDSEDRMRQFITDASHELRTPLTTIRGFAELYRQGAARDVGMLLSRIESEASRMGLLVDDLLLLARLDAHRPLELCRVDLLALASDAAHDARAMDPKRRITLEVLDGPGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEVADDGPGMSQEDALRVFERFYRADSSRARASGGTGLGLSIVDSLVAAHGGAVTVTTALGEGCCFRVSLPRVSDVDQLSLTPVVPGPP