phoR Resolved · high auto-curated
H37Rv Rv0758 · MTBC0 mtbc0_000807 ·
485 aa ·
856821–858278 MTBC0
(+) ·
RefSeq NP_215272.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | two component system response sensor kinase PhoR |
|---|---|
| MTBC0 PGAP re-annotation | sensory box histidine kinase PhoR |
| Revised (this work) | Sensory box histidine kinase PhoR. Pfam: HAMP (PF00672.31), HisKA (PF00512.32), HATPase_c (PF02518.32). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 46 publications
46 TB publications mention this gene. 46 publication(s) discuss this gene (44 in a M. tuberculosis context, 1 in other mycobacteria — M. abscessus (1)).
| Publication | Date |
|---|---|
| PhoPR variants from several phylogenetic lineages of tuberculosis bacilli respond differently to extracellular signals. doi:10.1128/mbio.00939-26 | 2026 |
| In Host Mutational Adaptation of Mycobacterium Tuberculosis Complex Strains During Tuberculosis Infection. doi:10.1093/infdis/jiag209 | 2026 |
| Different transcriptional regulatory activities of Mycobacterium bovis and Mycobacterium tuberculosis PhoPR systems. doi:10.1099/acmi.0.001087.v3 | 2026 |
| Tamoxifen inhibits histidine kinases of M. tuberculosis two-component signaling systems. doi:10.1128/spectrum.01880-25 | 2026 |
| Mycobacterium tuberculosis growth arrest on propionate at acidic pH is suppressed by mutations in phoPR and pyrazinamide treatment. doi:10.1128/mbio.02955-25 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 2 % of gene
| Neighbour | hit (Rv0759c, - strand) |
|---|---|
| Overlap | 29 bp, 2 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.09 (95% CI -2.76 to 3.61). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Sensor part of a two component regulatory system. This protein is thought to be a sensor kinase for the phosphate regulon. Transcription of this operon is positively regulated by PHOB|Rv0757 and PHOR when phosphate is limited. |
|---|---|
| Mycobrowser EC |
2.7.13.3
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0781
· 99.6% identity |
|---|---|
| M. marinum |
MMAR_4941
· 73.9% identity |
| M. smegmatis |
MSMEG_5870
· 71.0% identity |
| M. orygis |
RJtmp_000804
· 99.6% identity |
| M. abscessus |
MAB_0674
· 63.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P71815
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | histidine kinase |
| EC (curated) |
EC 2.7.13.3
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| Preferred name | phoR |
| eggNOG description | Histidine kinase |
| Orthologous group | COG5002 |
| EC number |
EC 2.7.13.3
|
| KEGG orthology |
K02484
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.508 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.381 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 75.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 48.0% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 18 in the ORF — 0 in the essential state, 0 growth-defect, 18 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 85. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -6.54 | 0.0 | required |
| fitness in mouse infection (in vivo) | -6.21 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.81 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.45 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.28 | 0.008 | required |
| fitness in mouse infection (in vivo) | -5.27 | 0.0074 | required |
| fitness in mouse infection (in vivo) | -5.10 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.08 | 0.034 | required |
| fitness in mouse infection (in vivo) | -5.04 | 0.021 | required |
| fitness in mouse infection (in vivo) | -4.98 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.93 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.89 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 69 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 48.7 ppm · rank 1769/3519 (49.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (2 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 2 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 485 aa |
|---|---|
| Molecular weight | 52.0 kDa |
| Theoretical pI | 6.58 |
| GRAVY | 0.001 (hydrophobic) |
| Aliphatic index | 105.2 |
| Aromaticity | 0.035 |
| Instability index | 39.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HAMP | PF00672.31 | 5.3e-11 | 179–230 | HAMP domain |
HisKA | PF00512.32 | 5.3e-18 | 250–312 | His Kinase A (phospho-acceptor) domain |
HATPase_c | PF02518.32 | 1.7e-31 | 358–468 | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5ukv |
X-ray diffraction | 1.9 Å | 15% |
5uky |
X-ray diffraction | 2.02 Å | 15% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 86.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4u7o-assembly1_A |
1.00 | 0.85 | 6.5e-17 sig | 4u7o-assembly1_A Active histidine kinase bound with ATP |
4zki-assembly1_A |
1.00 | 0.85 | 1.9e-16 sig | 4zki-assembly1_A The crystal structure of Histidine Kinase YycG with ADP |
5c93-assembly1_A |
1.00 | 0.84 | 7.6e-17 sig | 5c93-assembly1_A Histidine kinase with ATP |
4q20-assembly1_B |
1.00 | 0.77 | 1.0e-16 sig | 4q20-assembly1_B Crystal structure of a C-terminal part of tyrosine kinase (DivL) from Caulobacter crescentus CB15 at 2.50 A resolution (PSI Community Target, Shapiro) |
3dge-assembly3_A |
1.00 | 0.67 | 3.0e-18 sig | 3dge-assembly3_A Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism |
Foldseek search of the AlphaFold DB model (mean pLDDT 86.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | phoP (+ strand, 44 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0759c (- strand, -29 bp gap) |
| Predicted operon |
phoP · phoR
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: phoP (two component system response transcriptional positive regulator PhoP), high confidence from genomic context alone (score 975 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0757 phoP |
two component system response transcriptional positive regulator PhoP | 999 | 975 ctx | neighborhood:817 cooccurence:772 textmining:978 |
Rv3765c tcrX |
two component transcriptional regulator TcrX | 880 | 859 ctx | cooccurence:748 |
Rv3246c mtrA |
two component DNA-binding response regulator MtrA | 866 | 855 ctx | cooccurence:746 |
Rv1033c trcR |
two component transcriptional regulator TrcR | 896 | 853 ctx | cooccurence:743 |
Rv0903c prrA |
two component transcriptional regulator PrrA | 860 | 853 ctx | cooccurence:740 |
Rv0602c tcrA |
two component DNA binding transcriptional regulator TcrA | 877 | 852 ctx | cooccurence:742 |
Rv0491 regX3 |
two component sensory transduction protein RegX | 915 | 849 ctx | cooccurence:727 textmining:462 |
Rv3454 |
Rv3454, (MTCY13E12.07), len: 422 aa. Probable conserved integral membrane protein, showing some similarity to various proteins (generally tr | 836 | 836 ctx | fusion:836 |
Rv0981 mprA |
two-component response regulator MrpA | 833 | 825 ctx | cooccurence:665 |
Rv1027c kdpE |
transcriptional regulator KdpE | 784 | 756 ctx | cooccurence:575 |
Rv0756c hyp |
hypothetical protein | 747 | 736 ctx | neighborhood:733 |
Rv2884 |
transcriptional regulator | 800 | 716 ctx | cooccurence:500 |
Rv0818 |
transcriptional regulator | 758 | 658 | |
Rv0983 pepD |
serine protease PepD | 589 | 572 | coexpression:410 |
Rv1223 htrA |
serine protease HtrA | 516 | 495 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: two component system response sensor kinase PhoR
- MTBC0 PGAP product: sensory box histidine kinase PhoR
- Pfam (hmmscan --cut_ga): HAMP PF00672.31 (E=5e-11), HisKA PF00512.32 (E=5e-18), HATPase_c PF02518.32 (E=2e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215272.1)
- Domains: Pfam-A via hmmscan --cut_ga — HAMP (PF00672.31), HisKA (PF00512.32), HATPase_c (PF02518.32)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5002 - Curated reference: UniProt P71815 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 86.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
phoP - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000807|Rv0758|phoR MARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSRIDRVLLEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNTAIPAVPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADVRSTVRSLVLLQVGIGSAVLVVLGVAGYAVVRRSLRPLAEFEQTAAAIGAGQLDRRVPQWHPRTEVGRLSLALNGMLAQIQRAVASAESSAEKARDSEDRMRQFITDASHELRTPLTTIRGFAELYRQGAARDVGMLLSRIESEASRMGLLVDDLLLLARLDAHRPLELCRVDLLALASDAAHDARAMDPKRRITLEVLDGPGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEVADDGPGMSQEDALRVFERFYRADSSRARASGGTGLGLSIVDSLVAAHGGAVTVTTALGEGCCFRVSLPRVSDVDQLSLTPVVPGPP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for phoR? Email the maintainer — the message is pre-filled with this gene's details.