adhB Resolved · high auto-curated
H37Rv Rv0761c · MTBC0 - ·
375 aa ·
854699–855826 H37Rv
(-) ·
RefSeq YP_177754.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | alcohol dehydrogenase B |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Alcohol dehydrogenase B. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Treatment and outcomes of multidrug-resistant tuberculosis in Auckland, 1995-2018. doi:10.1111/imj.15341 | 2022 |
| Metabolic adaptation of Mycobacterium avium subsp. paratuberculosis to the gut environment. doi:10.1099/mic.0.062737-0 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.25 (95% CI -0.62 to 4.08). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to catalyze the reversible oxidation of ethanol to acetaldehyde with the concomitant reduction of NAD. Probably acts on primary or secondary alcohols or hemiacetals [catalytic activity: an alcohol + NAD+ = an aldehyde or ketone + NADH]. |
|---|---|
| Mycobrowser EC |
1.1.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0784c
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_4935
· 87.2% identity |
| M. smegmatis |
MSMEG_5866
· 80.8% identity |
| M. orygis |
RJtmp_000807
· 99.7% identity |
| M. abscessus |
MAB_4560
· 58.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQC7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Alcohol dehydrogenase B |
| EC (curated) |
EC 1.1.1.1
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | adhB |
| eggNOG description | alcohol dehydrogenase |
| Orthologous group | COG1062 |
| EC number |
EC 1.1.1.1, EC 1.1.1.284
|
| KEGG orthology |
K00121
|
| KEGG pathways |
map00010, map00071, map00350, map00625, map00626, map00680, map00830, map00980, map00982, map01100, map01110, map01120, map01130, map01200, map01220, map05204
|
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.324 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 86.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 46.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) cholesterol-required
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 179.384615385. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Cholesterol catabolism | required for growth on cholesterol (Griffin 2011) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) carbon source
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| cholesterol | carbon source | mutant depleted (gene required) | -1.952 | -7.802 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness on cholesterol (vs glycerol) (carbon source) | -4.62 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1915.0 ppm · rank 84/3519 (97.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 375 aa |
|---|---|
| Molecular weight | 39.7 kDa |
| Theoretical pI | 5.1 |
| GRAVY | 0.115 (hydrophobic) |
| Aliphatic index | 93.3 |
| Aromaticity | 0.067 |
| Instability index | 24.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ADH_N | PF08240.18 | 1.4e-25 | 27–156 | Alcohol dehydrogenase GroES-like domain |
ADH_zinc_N | PF00107.33 | 4.4e-21 | 197–330 | Zinc-binding dehydrogenase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8e7u-assembly1_A |
1.00 | 0.92 | 2.1e-41 sig | 8e7u-assembly1_A F93A Horse Liver Alcohol Dehydrogenase in Complex with NADH and N-Cyclohexylformamide |
7u9n-assembly1_A |
1.00 | 0.92 | 2.2e-41 sig | 7u9n-assembly1_A S48A Horse Liver Alcohol Dehydrogenase in Complex with NADH and N-Cyclohexylformamide |
5cds-assembly1_B |
1.00 | 0.92 | 3.7e-41 sig | 5cds-assembly1_B I220L horse liver alcohol dehydrogenase complexed with NAD and pentafluorobenzyl alcohol |
8ecs-assembly1_B |
1.00 | 0.92 | 4.7e-41 sig | 8ecs-assembly1_B F93G Horse Liver Alcohol Dehydrogenase in Complex with NADH and N-Cyclohexylformamide |
5kjc-assembly1_A |
1.00 | 0.92 | 4.7e-41 sig | 5kjc-assembly1_A V222I horse liver alcohol dehydrogenase complexed with NAD+ and pentafluorobenzyl alcohol |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0760c (- strand, 12 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0762c (- strand, 98 bp gap) |
| Predicted operon |
Rv0760c · adhB
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: aldA (aldehyde dehydrogenase AldA), high confidence from genomic context alone (score 952 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0760c hyp |
hypothetical protein | 973 | 973 ctx | neighborhood:874 coexpression:797 |
Rv0768 aldA exp |
aldehyde dehydrogenase AldA | 954 | 952 ctx | neighborhood:438 database:900 |
Rv0147 exp |
aldehyde dehydrogenase | 924 | 921 | database:900 |
Rv3293 pcd exp |
piperideine-6-carboxylic acid dehydrogenase | 924 | 921 | database:900 |
Rv0223c exp |
aldehyde dehydrogenase | 924 | 921 | database:900 |
Rv0458 exp |
aldehyde dehydrogenase | 924 | 921 | database:900 |
Rv2579 dhaA exp |
haloalkane dehalogenase | 912 | 912 | database:900 |
Rv2296 dhmA1 exp |
haloalkane dehalogenase | 912 | 912 | database:900 |
Rv1833c dhmA2 exp |
haloalkane dehalogenase | 912 | 912 | database:900 |
Rv1703c exp |
methyltransferase | 905 | 905 | database:900 |
Rv3252c alkB exp |
transmembrane alkane 1-monooxygenase AlkB | 905 | 901 | database:900 |
Rv3170 aofH exp |
flavin-containing monoamine oxidase | 901 | 901 | database:900 |
Rv0762c hyp |
hypothetical protein | 806 | 806 ctx | neighborhood:774 |
Rv2213 pepB |
cytosol aminopeptidase | 796 | 784 | coexpression:756 |
Rv0764c cyp51 |
lanosterol 14-alpha demethylase | 778 | 776 ctx | neighborhood:774 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): alcohol dehydrogenase B
- Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=1e-25), ADH_zinc_N PF00107.33 (E=4e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177754.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1062 - Curated reference: UniProt P9WQC7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
61 functional partner(s); context anchor
aldA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0761c|adhB MKTKGALIWEFNQPWSVEEIEIGDPRKDEVKIQMEAAGMCRSDHHLVTGDIPMAGFPVLGGHEGAGIVTEVGPGVDDFAPGDHVVLAFIPSCGKCPSCQAGMRNLCDLGAGLLAGESVTDGSFRIQARGQNVYPMTLLGTFSPYMVVHRSSVVKIDPSVPFEVACLVGCGVTTGYGSAVRTADVRPGDDVAIVGLGGVGMAALQGAVSAGARYVFAVEPVEWKRDQALKFGATHVYPDINAALMGIAEVTYGLMAQKVIITVGKLDGADVDSYLTITAKGGTCVLTAIGSLVDTQVTLNLAMLTLLQKNIQGTIFGGGNPHYDIPKLLSMYKAGKLNLDDMVTTAYKLEQINDGYQDMLNGKNIRGVIRYTDDDR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for adhB? Email the maintainer — the message is pre-filled with this gene's details.