Rv0762c Family assigned · low auto-curated

H37Rv Rv0762c · MTBC0 mtbc0_000811 · 181 aa · 860349–860894 (-) · RefSeq NP_215276.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnuclear transport factor 2 family protein
Revised (this work)Nuclear transport factor 2 family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XW93 TrEMBL · unreviewed · Evidence at protein level
UniProt nameNuclear transport factor 2 family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group28NTV

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp51 (lanosterol 14-alpha demethylase), high confidence from genomic context alone (score 992 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0764c cyp51 lanosterol 14-alpha demethylase 992 992 ctx neighborhood:882 cooccurence:769 coexpression:744
Rv0765c oxidoreductase 981 981 ctx neighborhood:882 cooccurence:673 coexpression:553
Rv0763c ferredoxin 977 977 ctx neighborhood:882 cooccurence:750
Rv0767c HTH-type transcriptional regulator 961 962 ctx neighborhood:836 cooccurence:772
Rv0770 oxidoreductase 955 956 ctx neighborhood:677 cooccurence:531 coexpression:730
Rv0766c cyp123 cytochrome P450 Cyp123 952 952 ctx neighborhood:882 coexpression:431
Rv0771 4-carboxymuconolactone decarboxylase 935 936 ctx neighborhood:677 cooccurence:679 coexpression:431
Rv0311 hyp hypothetical protein 819 819 ctx cooccurence:774
Rv0768 aldA aldehyde dehydrogenase AldA 812 812 ctx neighborhood:758
Rv0769 oxidoreductase 811 811 ctx neighborhood:731
Rv0761c adhB alcohol dehydrogenase B 806 806 ctx neighborhood:774
Rv0760c hyp hypothetical protein 720 720 ctx neighborhood:578
Rv1628c hyp hypothetical protein 633 634 ctx cooccurence:632
Rv0926c hyp hypothetical protein 629 630 ctx cooccurence:626
Rv0310c hyp hypothetical protein 615 615 ctx cooccurence:615

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nuclear transport factor 2 family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215276.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28NTV
  • Curated reference: UniProt I6XW93 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor cyp51
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000811|Rv0762c|
MAGYPRDELEDVVHRWLQANRTAERRGDWTLLADFYTDDATYGWNVGPNEDVMCVGIDEIRDIALGQEMDGLQGWRYPYQRVVIDEKQGEVVGFWKQVATDANGAEQEVYGIGGSWFRYAGGGKWNWQRDFFDFGHVSALYLELIKAGKLSPGMQKRIERAVSGNKVPGYYPLGKTPVPLW