Rv0740 Still unknown · low auto-curated
H37Rv Rv0740 · MTBC0 mtbc0_000785 ·
175 aa · 835971–836498 (+) ·
RefSeq NP_215254.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF7956. Function unknown. Foldseek best (non-significant) hit: 7jxh-assembly2_A HER2 in complex with JBJ-08-178-01 (prob 0.08, TM 0.30). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53803
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Protein Rv0740 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2BZDT |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.159 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF7956 | PF25845.1 | 3.8e-99 | 1–148 | Domain of unknown function (DUF7956) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 53.3 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7jxh-assembly2_A |
0.08 | 0.30 | 8.3e-01 | 7jxh-assembly2_A HER2 in complex with JBJ-08-178-01 |
3w15-assembly1_A |
0.06 | 0.23 | 7.4e-01 | 3w15-assembly1_A Structure of peroxisomal targeting signal 2 (PTS2) of Saccharomyces cerevisiae 3-ketoacyl-CoA thiolase in complex with Pex7p and Pex21p |
5vja-assembly1_D |
0.06 | 0.29 | 1.5e+00 | 5vja-assembly1_D Crystal Structure of human zipper-interacting protein kinase (ZIPK, alias DAPK3) in complex with a pyrazolo[3,4-d]pyrimidinone ligand (HS38) |
4bn1-assembly1_A |
0.06 | 0.29 | 1.6e+00 | 4bn1-assembly1_A Crystal structure of V174M mutant of Aurora-A kinase |
5a14-assembly1_A |
0.06 | 0.22 | 4.2e-01 | 5a14-assembly1_A Human CDK2 with type II inhibitor |
7avy-assembly1_A |
0.05 | 0.25 | 1.1e+00 | 7avy-assembly1_A MerTK kinase domain in complex with quinazoline-based inhbitor |
5i9u-assembly1_A |
0.05 | 0.28 | 1.9e+00 | 5i9u-assembly1_A Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase |
3w2p-assembly1_A |
0.05 | 0.29 | 1.9e+00 | 3w2p-assembly1_A EGFR Kinase domain T790M/L858R mutant with compound 2 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0741 (Probable transposase (fragment); Rv0741, (MTV041.15), len: 104 aa. Probable truncated transposase for IS1557, showing similarity to transpos), medium confidence from genomic context alone (score 467 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0739 hyp |
hypothetical protein | 531 | 531 ctx | neighborhood:524 |
Rv0741 |
Probable transposase (fragment); Rv0741, (MTV041.15), len: 104 aa. Probable truncated transposase for IS1557, showing similarity to transpos | 467 | 467 ctx | neighborhood:460 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Pfam (hmmscan --cut_ga): DUF7956 PF25845.1 (E=4e-99)
- Foldseek best: 7jxh-assembly2_A HER2 in complex with JBJ-08-178-01 (prob 0.08, E=8e-01, TM=0.30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215254.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF7956 (PF25845.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BZDT - Curated reference: UniProt O53803 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 53.3, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
2 functional partner(s); context anchor
Rv0741 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000785|Rv0740| MLPKNTRPTSETAEEFWDNSLWCSWGDRETGYTRTVTVSICQVADGEREAEGVRDMMRLECPAGLDLRTPNPEAYEITGQRPGEFVFVLGYLGHVRAIVGNCYIEIMPMGTRVELSKLADVALDIGRSVGCSAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG