tpi Resolved · high auto-curated
H37Rv Rv1438 · MTBC0 mtbc0_001538 ·
261 aa ·
1624929–1625714 MTBC0
(+) ·
RefSeq NP_215954.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | triosephosphate isomerase |
|---|---|
| MTBC0 PGAP re-annotation | triose-phosphate isomerase |
| Revised (this work) | Triose-phosphate isomerase. Pfam: TIM (PF00121.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 20 publications
20 TB publications mention this gene. 20 publication(s) discuss this gene (22 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Genetic Characterization and Zoonotic Potential of Cryptosporidium spp. and Giardia duodenalis in Cattle From Northeast China. doi:10.1155/tbed/6148130 | 2025 |
| Integrated epidemiological and molecular analysis of Cryptosporidium spp. and Giardia duodenalis isolates in dairy calves from Terceira Island, Azores. doi:10.1007/s00436-025-08613-x | 2025 |
| Molecular Epidemiology of Cryptosporidium spp., Giardia duodenalis, and Enterocytozoon bieneusi in Guizhou Angus Calves: Dominance of Angus Cattle-Adapted Genotypes and Zoonotic Potential of E. bieneusi. doi:10.3390/microorganisms13081735 | 2025 |
| Occurrence and Genetic Diversity of Cryptosporidium spp. and Giardia intestinalis from Yaks (Bos grunniens) in Ganzi, Sichuan Province, China. doi:10.3390/microorganisms13061261 | 2025 |
| Risk of tuberculosis in individuals with type 2 diabetes mellitus based on the tuberculosis predictive index score: a case-control study in Indonesia. doi:10.24171/j.phrp.2024.0310 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | pgk (Rv1437, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -4.83 (95% CI -5.65 to -3.99). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Plays an important role in several metabolic pathways [catalytic activity: D-glyceraldehyde 3-phosphate = glycerone phosphate] |
|---|---|
| Mycobrowser EC |
5.3.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1473
· 99.6% identity |
|---|---|
| M. leprae |
ML0572
· 84.3% identity |
| M. marinum |
MMAR_2241
· 90.4% identity |
| M. smegmatis |
MSMEG_3086
· 82.8% identity |
| M. orygis |
RJtmp_001517
· 99.6% identity |
| M. abscessus |
MAB_2777c
· 83.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WG43
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Triosephosphate isomerase |
| EC (curated) |
EC 5.3.1.1
|
| Curated function | Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D-glyceraldehyde-3-phosphate (G3P). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| Preferred name | tpiA |
| eggNOG description | Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D-glyceraldehyde-3-phosphate (G3P) |
| Orthologous group | COG0149 |
| EC number |
EC 5.3.1.1
|
| KEGG orthology |
K01803
|
| KEGG pathways |
map00010, map00051, map00562, map00710, map01100, map01110, map01120, map01130, map01200, map01230
|
| KEGG modules |
M00001, M00002, M00003
|
| Gene Ontology (152) |
GO:0003674, GO:0003824, GO:0004807, GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0005975, GO:0005996 +140 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.226 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 88.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 65.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 16 in the ORF — 16 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | tpi-tetOn6 (TetON promoter 6) |
|---|---|
| Baseline knockdown fitness | 2.402 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 761.0 ppm · rank 293/3519 (91.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 261 aa |
|---|---|
| Molecular weight | 27.4 kDa |
| Theoretical pI | 5.54 |
| GRAVY | 0.091 (hydrophobic) |
| Aliphatic index | 103.2 |
| Aromaticity | 0.057 |
| Instability index | 28.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TIM | PF00121.25 | 1.1e-89 | 5–253 | Triosephosphate isomerase |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3ta6 |
X-ray diffraction | 1.41 Å | 100% |
3tao |
X-ray diffraction | 1.45 Å | 100% |
3gvg |
X-ray diffraction | 1.55 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3ta6-assembly1_A |
1.00 | 0.99 | 3.8e-51 sig | 3ta6-assembly1_A Structure of Mycobacterium tuberculosis triosephosphate isomerase |
4y9a-assembly2_C |
1.00 | 0.99 | 3.3e-39 sig | 4y9a-assembly2_C Crystal structure of Triosephosphate Isomerase from Streptomyces coelicolor |
5ibx-assembly2_B |
1.00 | 0.97 | 4.6e-32 sig | 5ibx-assembly2_B 1.65 Angstrom Crystal Structure of Triosephosphate Isomerase (TIM) from Streptococcus pneumoniae |
1yya-assembly1_B |
1.00 | 0.95 | 7.9e-32 sig | 1yya-assembly1_B Crystal structure of TT0473, putative Triosephosphate Isomerase from Thermus thermophilus HB8 |
4y96-assembly1_A |
1.00 | 0.96 | 4.9e-32 sig | 4y96-assembly1_A Crystal structure of Triosephosphate Isomerase from Gemmata obscuriglobus |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | pgk (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1439c (- strand, 611 bp gap) |
| Predicted operon |
gap · pgk · tpi
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pgk (phosphoglycerate kinase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1437 pgk |
phosphoglycerate kinase | 999 | 1000 ctx | neighborhood:882 fusion:900 cooccurence:656 coexpression:963 textmining:832 |
Rv1436 gap exp |
glyceraldehyde 3-phosphate dehydrogenase | 999 | 1000 ctx | neighborhood:882 fusion:471 cooccurence:680 coexpression:879 experimental:526 database:900 textmining:715 |
Rv0946c pgi exp |
glucose-6-phosphate isomerase | 995 | 979 | coexpression:851 database:800 textmining:804 |
Rv0363c fba exp |
fructose-bisphosphate aldolase | 995 | 977 | coexpression:763 database:900 textmining:831 |
Rv1023 eno exp |
enolase | 985 | 941 | coexpression:858 experimental:476 textmining:762 |
Rv0727c fucA exp |
L-fuculose phosphate aldolase FucA | 941 | 923 | database:900 |
Rv1448c tal exp |
transaldolase | 969 | 908 | coexpression:440 database:800 textmining:680 |
Rv1449c tkt exp |
transketolase | 977 | 907 | coexpression:447 database:800 textmining:769 |
Rv1617 pykA |
pyruvate kinase | 958 | 905 ctx | cooccurence:561 coexpression:781 textmining:576 |
Rv0478 deoC exp |
2-deoxyribose-5-phosphate aldolase | 881 | 845 | database:800 |
Rv0489 gpm1 |
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase | 948 | 824 | coexpression:787 textmining:720 |
Rv1121 zwf1 exp |
glucose-6-phosphate 1-dehydrogenase | 871 | 818 | database:800 |
Rv1447c zwf2 exp |
glucose-6-phosphate 1-dehydrogenase | 891 | 814 | database:800 textmining:440 |
Rv3010c pfkA |
6-phosphofructokinase | 945 | 811 | coexpression:707 textmining:725 |
Rv2881c cdsA |
phosphatidate cytidylyltransferase | 811 | 774 | coexpression:703 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: triosephosphate isomerase
- MTBC0 PGAP product: triose-phosphate isomerase
- Pfam (hmmscan --cut_ga): TIM PF00121.25 (E=1e-89)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215954.1)
- Domains: Pfam-A via hmmscan --cut_ga — TIM (PF00121.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0149 - Curated reference: UniProt P9WG43 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
173 functional partner(s); context anchor
pgk - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001538|Rv1438|tpi MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAGGPLP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for tpi? Email the maintainer — the message is pre-filled with this gene's details.