MTBC Gene Atlas

omamB Resolved · high

H37Rv Rv0200 · MTBC0 mtbc0_000214 · 229 aa · 237558–238247 (+) · RefSeq NP_214714.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Mce-associated membrane protein OmamB, a component of the Mce1 fatty-acid transporter. RefSeq leaves this locus 'hypothetical protein'. A forward genetic screen for reduced fatty-acid import by M. tuberculosis within macrophages identified Rv0200/OmamB among the putative components of the Mce1 fatty-acid transporter, alongside Rv3723/LucA, Rv0172/Mce1D and Rv0655/MceG (Nazarova 2019). Paralogue of OmamA (Rv0199). Experimentally characterised, not a structural prediction.

Curated reference (UniProt)

UniProt O53651 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A2U6

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.064 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 12 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0199 (membrane protein), high confidence from genomic context alone (score 885 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0199 membrane protein 955 885 ctx neighborhood:882 textmining:622
Rv0198c zmp1 zinc metalloprotease 795 784 ctx neighborhood:758
Rv2048c pks12 polyketide synthase 770 743 experimental:470 database:508
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 764 737 experimental:470 database:508
Rv2940c mas multifunctional mycocerosic acid synthase 764 736 experimental:470 database:508
Rv1527c pks5 polyketide synthase 763 735 experimental:470 database:508
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 762 735 experimental:470 database:508
Rv1691 hyp hypothetical protein 741 730 experimental:417 database:540
Rv2267c stf3 hyp hypothetical protein 740 729 experimental:417 database:540
Rv3529c hyp hypothetical protein 740 729 experimental:417 database:540
Rv1663 pks17 polyketide synthase 738 729 experimental:458 database:508
Rv1334 mec [CysO 729 719 experimental:404 database:546
Rv1277 hyp hypothetical protein 702 703 experimental:438 database:493
Rv3696c glpK glycerol kinase 708 696 database:502
Rv1389 gmk guanylate kinase 707 695 experimental:411 database:491

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • RefSeq: hypothetical / membrane protein of unknown function
  • Mce-associated membrane protein; renamed OmamB; paralogue of OmamA (Rv0199)
  • Required for fatty-acid import within macrophages; putative Mce1 fatty-acid transporter component (Nazarova 2019, PMID 30735132)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214714.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A2U6
  • Curated reference: UniProt O53651 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 254 functional partner(s); context anchor Rv0199
  • Primary literature: Nazarova EV, Montague CR, Huang L, La T, Russell D, VanderVen BC (2019). The genetic requirements of fatty acid import by Mycobacterium tuberculosis within macrophages eLife 8:e43621. doi:10.7554/eLife.43621 PMID:30735132

Ancestral MTBC0 protein sequence

>mtbc0_000214|Rv0200|omamB
MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLLVVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFNRDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRGVTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLDVTPINAR