Rv0725c Family assigned · medium auto-curated
H37Rv Rv0725c · MTBC0 - ·
301 aa · 817539–818444 (-) ·
RefSeq NP_215239.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains LCM (PF04072.21) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P95073
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | S-adenosyl-L-methionine-dependent methyltransferase |
| EC (curated) |
EC 2.1.1.-
|
| Curated function | Exhibits S-adenosyl-L-methionine-dependent methyltransferase activity. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | Exhibits S-adenosyl-L-methionine-dependent methyltransferase activity |
| Orthologous group | COG3315 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.063 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 6 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (176) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LCM | PF04072.21 | 4.8e-67 | 19–193 | Leucine carboxyl methyltransferase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0726c (S-adenosylmethionine-dependent methyltransferase), medium confidence from genomic context alone (score 649 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2751 hyp |
hypothetical protein | 762 | 763 ctx | cooccurence:762 |
Rv0726c |
S-adenosylmethionine-dependent methyltransferase | 650 | 649 ctx | neighborhood:587 |
Rv2794c pptT |
4'-phosphopantetheinyl transferase | 414 | 415 ctx | cooccurence:411 |
Rv0728c serA2 |
D-3-phosphoglycerate dehydrogenase SerA | 520 | 353 | |
Rv1392 metK |
S-adenosylmethionine synthetase | 484 | 85 | textmining:459 |
Rv1079 metB |
cystathionine gamma-synthase | 636 | 68 | textmining:626 |
Rv0761c adhB |
alcohol dehydrogenase B | 805 | 55 | textmining:803 |
Rv0469 umaA |
mycolic acid synthase UmaA | 630 | 44 | textmining:629 |
Rv2118c trmI |
tRNA (adenine(58)-N(1))-methyltransferase | 803 | 41 | textmining:803 |
Rv2996c serA1 |
D-3-phosphoglycerate dehydrogenase | 730 | 41 | textmining:730 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): LCM PF04072.21 (E=5e-67)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215239.1)
- Domains: Pfam-A via hmmscan --cut_ga — LCM (PF04072.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3315 - Curated reference: UniProt P95073 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
Rv0726c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0725c| MPRAHDDNWDLASSVGATATMVAAGRALATKDPRGLINDPFAEPLVRAVGLDFFTKLIDGELDIATTGNLSPGRAQAMIDGIAVRTKYFDDYFRTATDGGVRQVVILAAGLDARAYRLPWPAGTVVYEIDQPQVIDFKTTTLAGIGAKPTAIRRTVYIDLRADWPAALQAAGLDSTAPTAWLAEGMLIYLPPDPRTGCSTTAPNSVLRAARSLPNLSRALWISTQAGYEKWRIRFASTAWTSTWRRWCIPANAATSSTTCAPRAGTLRAQCGPTYSGAMVCPFPPHTTTIRSAKSSSSAVV