Rv0575c Resolved · high auto-curated
H37Rv Rv0575c · MTBC0 mtbc0_000605 ·
388 aa · 672130–673296 (-) ·
RefSeq NP_215089.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | FAD-binding domain |
| Revised (this work) | FAD-binding domain. Pfam: FAD_binding_3 (PF01494.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53772
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible oxidoreductase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversionH Coenzyme transport and metabolism
|
|---|---|
| eggNOG description | FAD binding domain |
| Orthologous group | COG0654 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.382 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 7 missense, 0 nonsense, 4 frameshift |
| Disruption | 4 distinct premature-stop/frameshift site(s); most common in 11.87% of strains (17241) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FAD_binding_3 | PF01494.26 | 3.2e-20 | 2–332 | FAD binding domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0576 (transcriptional regulator), medium confidence from genomic context alone (score 561 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1405c |
methyltransferase | 766 | 758 | coexpression:757 |
Rv1403c |
methyltransferase | 726 | 716 | coexpression:716 |
Rv1814 erg3 |
membrane-bound C-5 sterol desaturase | 639 | 611 | coexpression:401 |
Rv0576 |
transcriptional regulator | 561 | 561 ctx | neighborhood:552 |
Rv0573c pncB2 |
nicotinic acid phosphoribosyltransferase PncB2 | 577 | 552 ctx | neighborhood:470 |
Rv0577 TB27.3 hyp |
hypothetical protein | 554 | 544 ctx | neighborhood:539 |
Rv2130c mshC |
cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase | 514 | 514 ctx | neighborhood:511 |
Rv0574c hyp |
hypothetical protein | 506 | 506 ctx | neighborhood:483 |
Rv1181 pks4 |
polyketide beta-ketoacyl synthase | 501 | 444 | |
Rv1745c idi |
isopentenyl-diphosphate delta-isomerase | 480 | 439 | coexpression:439 |
Rv0062 celA1 |
cellulase CelA | 425 | 426 ctx | cooccurence:424 |
Rv1527c pks5 |
polyketide synthase | 504 | 410 | |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 502 | 408 | |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 498 | 403 | |
Rv3377c |
type B diterpene cyclase | 447 | 403 | coexpression:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: oxidoreductase
- MTBC0 PGAP product: FAD-binding domain
- Pfam (hmmscan --cut_ga): FAD_binding_3 PF01494.26 (E=3e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215089.1)
- Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_3 (PF01494.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0654 - Curated reference: UniProt O53772 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv0576 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000605|Rv0575c| MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFWGVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKVKADLGVDVFRRMVGDDFTSLPRGDLAAAIYTTIEDQVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNVRRLVFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFRAEHDNPGVAPKDELRDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLIGDAAGCISLLGGEGTGLAITEAYVLAGELARAGGDHRRAFDAYEKRLRPFIEGKQASAAKFIWFFATRTRFGLWFRNVAMRTMNFGPLATLFAGSVRDDFELPDYTW