Rv0572c Family assigned · medium auto-curated

H37Rv Rv0572c · MTBC0 mtbc0_000602 · 113 aa · 668593–668934 (-) · RefSeq NP_215086.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains MT0599 (PF25859.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM81 SwissProt · reviewed · Evidence at transcript level
UniProt nameUncharacterized protein Rv0572c

UniProt still lists this protein as Uncharacterized protein Rv0572c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BGCK

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.951 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (286) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MT0599PF25859.1 3.2e-3827–87 Mycobacterial dormancy-induced protein MT0599

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0571c hyp hypothetical protein 701 468 ctx neighborhood:435 textmining:461
Rv1812c dehydrogenase 853 288 textmining:803
Rv2003c hyp hypothetical protein 733 254 textmining:657
Rv3134c universal stress protein 466 98 textmining:433
Rv2625c rip3 zinc metalloprotease Rip3 537 95 textmining:510
Rv2631 rtcB RNA-splicing ligase RtcB 668 87 textmining:652
Rv3129 Rv3129, (MTCY164.40), len: 110 aa. Conserved hypothetical protein, with some similarity to various hypothetical proteins from Streptomyces c 812 85 textmining:803
Rv3127 hyp hypothetical protein 661 70 textmining:651
Rv1734c hyp hypothetical protein 519 55 textmining:512
Rv1738 hyp hypothetical protein 448 55 textmining:440
Rv3126c hyp hypothetical protein 805 51 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): MT0599 PF25859.1 (E=3e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215086.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MT0599 (PF25859.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BGCK
  • Curated reference: UniProt P9WM81 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000602|Rv0572c|
MGEHAIKRHMRQRKPTKHPLAQKRGARILVLTDDPRRSVLIVPGCHLDSMRREKNAYYFQDGNALVGMVVSGGTVEYDADDRTYVVQLTDGRHTTESSFEHSSPSRSPQSDDL