lpqN Family assigned · medium auto-curated

H37Rv Rv0583c · MTBC0 mtbc0_000613 · 228 aa · 681940–682626 (-) · RefSeq NP_215097.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqN
MTBC0 PGAP re-annotationLpqN/LpqT family lipoprotein
Revised (this work)LpqN/LpqT family lipoprotein. Pfam: Lpp-LpqN (PF10738.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53780 SwissProt · reviewed · Evidence at protein level
UniProt nameLipoprotein LpqN
Curated functionInvolved in cell envelope biogenesis. May act as a membrane fusion protein, connecting MmpL transporters with periplasmic proteins, and play a role in cell envelope lipid changes during biofilm maturation..; FUNCTION: Is also a virulence factor required for intracellular survival. Associates with CBL, a host ubiquitin ligase, and probably blocks the normal functions of CBL and disturbs CBL-mediated antibacterial activity. Interaction counteracts antibacterial defense but causes a reciprocal enhancement of antiviral defense.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelpqN
eggNOG descriptionProbable lipoprotein LpqN
Orthologous group2FK6M

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.353 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lpp-LpqNPF10738.16 2.1e-5957–227 Probable lipoprotein LpqN

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0584 (glycosidase), high confidence from genomic context alone (score 772 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0584 glycosidase 771 772 ctx neighborhood:771
Rv1270c lprA lipoprotein LprA 755 83 textmining:745
Rv0418 lpqL lipoprotein aminopeptidase LpqL 724 75 textmining:715
Rv2299c htpG chaperone protein HtpG 566 70 textmining:553
Rv3763 lpqH lipoprotein LpqH 687 55 textmining:683
Rv1368 lprF lipoprotein LprF 819 52 textmining:818
Rv1876 bfrA bacterioferritin BfrA 433 51 textmining:427
Rv0350 dnaK chaperone protein DnaK 417 51 textmining:411
Rv3006 lppZ lipoprotein LppZ 836 50 textmining:835
Rv1411c lprG lipoprotein LprG 722 50 textmining:720
Rv2945c lppX lipoprotein LppX 794 47 textmining:793
Rv2873 mpt83 cell surface lipoprotein 484 47 textmining:481
Rv3418c groES chaperonin GroES 452 47 textmining:449
Rv0033 acpA acyl carrier protein AcpA 429 47 textmining:425
Rv1816 HTH-type transcriptional regulator 641 46 textmining:640

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqN
  • MTBC0 PGAP product: LpqN/LpqT family lipoprotein
  • Pfam (hmmscan --cut_ga): Lpp-LpqN PF10738.16 (E=2e-59)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215097.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lpp-LpqN (PF10738.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2FK6M
  • Curated reference: UniProt O53780 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv0584
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000613|Rv0583c|lpqN
MKHFTAAVATVALSLALAGCSFNIKTDSAPTTSPTTTSPTTSTTTTSATTSAQAAGPNYTIADYIRDNHIQETPVHHGDPGSPTIDLPVPDDWRLLPESSRAPYGGIVYTQPADPNDPPTIVAILSKLTGDIDPAKVLQFAPGELKNLPGFQGSGDGSAATLGGFSAWQLGGSYSKNGKLRTVAQKTVVIPSQGAVFVLQLNADALDDETMTLMDAANVIDEQTTITP