Rv0571c Family assigned · medium auto-curated
H37Rv Rv0571c · MTBC0 mtbc0_000601 ·
443 aa · 667038–668369 (-) ·
RefSeq NP_215085.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | phosphoribosyltransferase family protein |
| Revised (this work) | Phosphoribosyltransferase family protein. Pfam: Pribosyltran (PF00156.34), DLH (PF01738.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WHK1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative phosphoribosyl transferase Rv0571c |
UniProt still lists this protein as Putative phosphoribosyl transferase Rv0571c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | phosphoribosyl transferase |
| Orthologous group | COG1073 |
| KEGG orthology |
K07100
|
| Gene Ontology (11) |
GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0030312, GO:0044424, GO:0044444, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.962 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (281) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pribosyltran | PF00156.34 | 6.2e-12 | 12–164 | Phosphoribosyl transferase domain |
DLH | PF01738.25 | 9.7e-05 | 244–425 | Dienelactone hydrolase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rip3 (zinc metalloprotease Rip3), medium confidence from genomic context alone (score 638 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2004c hyp |
hypothetical protein | 935 | 888 | coexpression:824 textmining:449 |
Rv2006 otsB1 |
trehalose-6-phosphate phosphatase OtsB | 847 | 847 | coexpression:802 |
Rv2003c hyp |
hypothetical protein | 825 | 799 | coexpression:799 |
Rv2630 hyp |
hypothetical protein | 795 | 796 | coexpression:780 |
Rv0570 nrdZ |
vitamin B12-dependent ribonucleoside-diphosphate reductase | 853 | 792 | coexpression:791 |
Rv0574c hyp |
hypothetical protein | 785 | 783 ctx | cooccurence:668 |
Rv3132c devS |
two component sensor histidine kinase DevS | 772 | 772 | coexpression:759 |
Rv2005c |
universal stress protein | 702 | 702 | coexpression:624 |
Rv1997 ctpF |
cation transporter ATPase F | 825 | 653 | coexpression:533 textmining:519 |
Rv2625c rip3 |
zinc metalloprotease Rip3 | 815 | 638 ctx | cooccurence:606 textmining:510 |
Rv2631 rtcB |
RNA-splicing ligase RtcB | 781 | 538 | coexpression:431 textmining:546 |
Rv2629 hyp |
hypothetical protein | 489 | 489 | |
Rv0572c hyp |
hypothetical protein | 701 | 468 ctx | neighborhood:435 textmining:461 |
Rv1734c hyp |
hypothetical protein | 463 | 450 ctx | cooccurence:424 |
Rv1832 gcvB |
glycine dehydrogenase | 449 | 449 | coexpression:430 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: phosphoribosyltransferase family protein
- Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=6e-12), DLH PF01738.25 (E=1e-04)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215085.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34), DLH (PF01738.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1073 - Curated reference: UniProt P9WHK1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
37 functional partner(s); context anchor
rip3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000601|Rv0571c| MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKSLQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIELQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPDDIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDAAADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGAGFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAGAALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVIPGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG