Rv0571c Family assigned · medium auto-curated

H37Rv Rv0571c · MTBC0 mtbc0_000601 · 443 aa · 667038–668369 (-) · RefSeq NP_215085.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationphosphoribosyltransferase family protein
Revised (this work)Phosphoribosyltransferase family protein. Pfam: Pribosyltran (PF00156.34), DLH (PF01738.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHK1 SwissProt · reviewed · Evidence at protein level
UniProt namePutative phosphoribosyl transferase Rv0571c

UniProt still lists this protein as Putative phosphoribosyl transferase Rv0571c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionphosphoribosyl transferase
Orthologous groupCOG1073
KEGG orthology K07100
Gene Ontology (11) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0030312, GO:0044424, GO:0044444, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.962 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (281) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PribosyltranPF00156.34 6.2e-1212–164 Phosphoribosyl transferase domain
DLHPF01738.25 9.7e-05244–425 Dienelactone hydrolase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rip3 (zinc metalloprotease Rip3), medium confidence from genomic context alone (score 638 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2004c hyp hypothetical protein 935 888 coexpression:824 textmining:449
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 847 847 coexpression:802
Rv2003c hyp hypothetical protein 825 799 coexpression:799
Rv2630 hyp hypothetical protein 795 796 coexpression:780
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 853 792 coexpression:791
Rv0574c hyp hypothetical protein 785 783 ctx cooccurence:668
Rv3132c devS two component sensor histidine kinase DevS 772 772 coexpression:759
Rv2005c universal stress protein 702 702 coexpression:624
Rv1997 ctpF cation transporter ATPase F 825 653 coexpression:533 textmining:519
Rv2625c rip3 zinc metalloprotease Rip3 815 638 ctx cooccurence:606 textmining:510
Rv2631 rtcB RNA-splicing ligase RtcB 781 538 coexpression:431 textmining:546
Rv2629 hyp hypothetical protein 489 489
Rv0572c hyp hypothetical protein 701 468 ctx neighborhood:435 textmining:461
Rv1734c hyp hypothetical protein 463 450 ctx cooccurence:424
Rv1832 gcvB glycine dehydrogenase 449 449 coexpression:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: phosphoribosyltransferase family protein
  • Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=6e-12), DLH PF01738.25 (E=1e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215085.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34), DLH (PF01738.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1073
  • Curated reference: UniProt P9WHK1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor rip3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000601|Rv0571c|
MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKSLQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIELQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPDDIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDAAADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGAGFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAGAALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVIPGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG