vapB26 Resolved · high auto-curated
H37Rv Rv0581 · MTBC0 mtbc0_000611 ·
71 aa · 681261–681476 (+) ·
RefSeq NP_215095.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin VapB26 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system antitoxin VapB26 |
| Revised (this work) | Type II toxin-antitoxin system antitoxin VapB26. Pfam: RHH_1 (PF01402.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53778
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin VapB26 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC26. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Ribbon-helix-helix protein, copG family |
| Orthologous group | 2BT89 |
| Gene Ontology (6) |
GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RHH_1 | PF01402.28 | 2.1e-07 | 4–39 | Ribbon-helix-helix protein, copG family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: vapC26 (ribonuclease VapC26), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0582 vapC26 |
ribonuclease VapC26 | 999 | 1000 ctx | neighborhood:882 experimental:999 textmining:437 |
Rv2549c vapC20 |
ribonuclease VapC20 | 682 | 668 | experimental:652 |
Rv0580c hyp |
hypothetical protein | 601 | 601 ctx | neighborhood:599 |
Rv1398c vapB10 |
antitoxin VapB10 | 514 | 49 | textmining:510 |
Rv0579 hyp |
hypothetical protein | 870 | 47 | textmining:870 |
Rv0865 mog |
molybdopterin biosynthesis protein | 520 | 47 | textmining:517 |
Rv0550c vapB3 |
antitoxin VapB3 | 439 | 46 | textmining:437 |
Rv2278 |
Rv2278, (MTCY339.32c), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase s | 521 | 45 | textmining:519 |
Rv1608c bcpB |
peroxiredoxin | 546 | 44 | textmining:545 |
Rv2656c |
prophage protein | 438 | 44 | textmining:437 |
Rv0718 rpsH |
30S ribosomal protein S8 | 436 | 42 | textmining:436 |
Rv0664 vapB8 |
antitoxin VapB8 | 544 | 41 | textmining:544 |
Rv2355 |
Probable transposase; Rv2355, (MTCY98.24), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos | 519 | 41 | textmining:519 |
Rv2760c vapB42 |
antitoxin VapB42 | 438 | 41 | textmining:438 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antitoxin VapB26
- MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB26
- Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=2e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215095.1)
- Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BT89 - Curated reference: UniProt O53778 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
vapC26 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000611|Rv0581|vapB26 MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPPPRGGLYAGSEPIARRVDELLAGFGER