yrbE4B Family assigned · medium auto-curated

H37Rv Rv3500c · MTBC0 mtbc0_003715 · 280 aa · 3943802–3944644 MTBC0 (-) · RefSeq NP_218017.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: MlaE (PF02405.22).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
Engineering phytosterol transport system in Mycobacterium sp. strain MS136 enhances production of 9α-hydroxy-4-androstene-3,17-dione. doi:10.1007/s10529-018-2520-9 2018
Expression profile of mce4 operon of Mycobacterium tuberculosis following environmental stress. doi:10.1016/j.ijmyco.2016.08.004 2016
Comparative analysis of genes encoding key steroid core oxidation enzymes in fast-growing Mycobacterium spp. strains. doi:10.1016/j.jsbmb.2013.02.016 2013

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.66 (95% CI -2.60 to 5.03). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionUnknown. Predicted to be involved in lipid catabolism.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3530c · 100.0% identity
M. marinum MMAR_4988 · 94.3% identity
M. smegmatis MSMEG_5901 · 85.0% identity
M. orygis RJtmp_003605 · 100.0% identity
M. abscessus MAB_4154c · 74.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6Y3P5 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved integral membrane protein YrbE4B. Possible ABC transporter

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred nameyrbE4B
eggNOG descriptionABC-type transport system involved in resistance to organic solvents, permease component
Orthologous groupCOG0767
KEGG orthology K02066
KEGG pathways map02010
KEGG modules M00210, M00669, M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.122 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 90.9% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 63.4%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) cholesterol-required

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 23 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 18 growth-advantage. Saturation 0.957, mean read count 285.863636364. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Cholesterol catabolismrequired for growth on cholesterol (Griffin 2011)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Conditional fitness (RB-TnSeq, 95 conditions) carbon sourcestress

ConditionGroupDirectionlog2 fitnesst
Hydrogen peroxide stress mutant depleted (gene required) -1.455 -8.652
cholesterol carbon source mutant depleted (gene required) -1.725 -6.853

Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (2 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness on cholesterol (vs glycerol) (carbon source) -3.900.0 required
fitness in mouse infection (in vivo) -2.720.013 required
fitness in mouse infection (in vivo) -2.530.0078 required
fitness in mouse infection (in vivo) -2.450.0 required
fitness in mouse infection (in vivo) -2.440.0 required
fitness in mouse infection (in vivo) -2.400.0 required
fitness in mouse infection (in vivo) -2.250.0 required
fitness in mouse infection (in vivo) -2.160.011 required
fitness in mouse infection (in vivo) -2.010.012 required
fitness in mouse infection (in vivo) -2.010.027 required
fitness in mouse infection (in vivo) -1.990.0 required
fitness in mouse infection (in vivo) -1.980.013 required

Conditional fitness of transposon-disruption mutants across 44 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 9 of 16 independent MS datasets
Integrated abundance12.8 ppm · rank 2569/3519 (27.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (5 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)5

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length280 aa
Molecular weight29.6 kDa
Theoretical pI7.85
GRAVY0.814 (hydrophobic)
Aliphatic index114.9
Aromaticity0.111
Instability index26.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MlaEPF02405.22 7.8e-5463–267 Permease MlaE

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.8

PDB hitprobTM-scoreE-valueDescription
8fef-assembly1_J 1.00 0.97 1.2e-20 sig 8fef-assembly1_J Structure of Mce1 transporter from Mycobacterium smegmatis (Map0)
8fee-assembly1_I 1.00 0.88 8.2e-09 sig 8fee-assembly1_I Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2)
7d06-assembly1_A 1.00 0.86 3.0e-08 sig 7d06-assembly1_A Cryo EM structure of the nucleotide free Acinetobacter MlaFEDB complex
7ch9-assembly1_H 1.00 0.85 1.2e-07 sig 7ch9-assembly1_H Cryo-EM structure of P.aeruginosa MlaFEBD
7ch9-assembly1_G 1.00 0.72 4.5e-09 sig 7ch9-assembly1_G Cryo-EM structure of P.aeruginosa MlaFEBD

Foldseek search of the AlphaFold DB model (mean pLDDT 87.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 10

Upstream (5' on genome)mce4A (- strand, 19 bp gap)
Downstream (3' on genome)yrbE4A (- strand, 34 bp gap)
Predicted operon Rv3492c · Rv3493c · mce4F · lprN · mce4D · mce4C · mce4B · mce4A · yrbE4B · yrbE4A

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (6 TF) whiB5 (activates) · Rv0023 (represses) · Rv0576 (activates) · mftR (represses) · phoP (represses) · devR (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mkl (ABC transporter ATP-binding protein), high confidence from genomic context alone (score 987 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0655 mkl exp ABC transporter ATP-binding protein 990 987 ctx cooccurence:774 coexpression:457 experimental:505 database:800
Rv3499c mce4A Mce family protein Mce4A 995 984 ctx neighborhood:859 cooccurence:768 textmining:737
Rv3497c mce4C Mce family protein Mce4C 991 982 ctx neighborhood:859 cooccurence:773 textmining:543
Rv3498c mce4B Mce family protein Mce4B 993 981 ctx neighborhood:859 cooccurence:773 textmining:665
Rv3496c mce4D Mce family protein Mce4D 991 981 ctx neighborhood:859 cooccurence:773 textmining:539
Rv3495c lprN Mce family lipoprotein LprN 986 981 ctx neighborhood:859 cooccurence:770
Rv3494c mce4F Mce family protein Mce4 995 977 ctx neighborhood:856 cooccurence:736 textmining:815
Rv3501c yrbE4A integral membrane protein 960 936 ctx neighborhood:833 textmining:407
Rv3492c Mce associated protein 917 917 ctx neighborhood:856 cooccurence:440
Rv0170 mce1B Mce family protein Mce1B 882 878 ctx cooccurence:773
Rv1971 mce3F Mce family protein Mce3F 902 875 ctx cooccurence:772
Rv0173 lprK Mce family lipoprotein LprK 902 874 ctx cooccurence:770
Rv0172 mce1D Mce family protein Mce1D 878 874 ctx cooccurence:766
Rv0590 mce2B Mce-family protein Mce2B; Rv0590, (MTCY19H5.32c), len: 275 aa. Mce2B; belongs to 24-membered Mycobacterium tuberculosis Mce protein family ( 908 872 ctx cooccurence:773
Rv0592 mce2D Mce family protein Mce2D 908 872 ctx cooccurence:771

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): MlaE PF02405.22 (E=8e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218017.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MlaE (PF02405.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0767
  • Curated reference: UniProt I6Y3P5 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor mkl
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003715|Rv3500c|yrbE4B
MSYDVTIRFRRFFSRLQRPVDNFGEQALFYGETMRYVPNAITRYRKETVRLVAEMTLGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGDIGIEALTGFLSAFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAVHSVSYLVSTRLIAGLVAIIPLYSLSVLAAFFAARFTTVFVNGQSAGLYDHYFNTFLIPSDLLWSFMQAIAMSIAVMLVHTYYGYNASGGSVGVGVAVGQAVRTSLIVVVVITLFISLAVYGASGNFNLSG