acpA Resolved · high auto-curated

H37Rv Rv0033 · MTBC0 mtbc0_000038 · 87 aa · 36593–36856 (+) · RefSeq NP_214547.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyl carrier protein AcpA
MTBC0 PGAP re-annotationacyl carrier protein
Revised (this work)Acyl carrier protein. Pfam: PP-binding (PF00550.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WX95 TrEMBL · unreviewed · Predicted
UniProt nameProbable acyl carrier protein AcpA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
Preferred nameacpP
eggNOG descriptionCarrier of the growing fatty acid chain in fatty acid biosynthesis
Orthologous groupCOG0236
EC number EC 6.2.1.50
KEGG orthology K02078, K12424

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.155 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PP-bindingPF00550.32 3.6e-115–66 Phosphopantetheine attachment site

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD34 (fatty-acid--CoA ligase FadD34), high confidence from genomic context alone (score 987 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0035 fadD34 fatty-acid--CoA ligase FadD34 987 987 ctx neighborhood:882 coexpression:865
Rv2524c fas fatty acid synthase 987 984 coexpression:647 experimental:895 database:549
Rv0034 hyp hypothetical protein 983 983 ctx neighborhood:882 coexpression:863
Rv0032 bioF2 8-amino-7-oxononanoate synthase 973 972 ctx neighborhood:781 coexpression:860
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 856 850 coexpression:427 experimental:449 database:564
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 851 845 coexpression:405 experimental:449 database:564
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 851 844 coexpression:401 experimental:449 database:564
Rv2243 fabD malonyl CoA-acyl carrier protein transacylase 889 837 coexpression:408 experimental:422 database:549
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 836 831 coexpression:413 experimental:449 database:518
Rv0310c hyp hypothetical protein 816 808 experimental:449 database:561
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 793 784 experimental:449 database:564
Rv2383c mbtB phenyloxazoline synthase 825 771 coexpression:662
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 760 761 experimental:449 database:561
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 754 755 experimental:449 database:561
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 750 750 experimental:449 database:561

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyl carrier protein AcpA
  • MTBC0 PGAP product: acyl carrier protein
  • Pfam (hmmscan --cut_ga): PP-binding PF00550.32 (E=4e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214547.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PP-binding (PF00550.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0236
  • Curated reference: UniProt I6WX95 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 174 functional partner(s); context anchor fadD34
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000038|Rv0033|acpA
MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA