Rv0028 Family assigned · low

H37Rv Rv0028 · MTBC0 mtbc0_000033 · 101 aa · 31500–31805 (+) · RefSeq NP_214542.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF2694 domain-containing protein
Revised (this work)ESX-1 secretion-associated protein (EspH-like). RefSeq leaves it 'hypothetical protein'.

Curated reference (UniProt)

UniProt P9WM97 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0028

UniProt still lists this protein as Uncharacterized protein Rv0028; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2694)
Orthologous group2AUU9

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.255 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (278) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2694PF10904.14 5.8e-611–97 Protein of unknown function (DUF2694)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 76.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7aor-assembly1_an 1.00 0.75 5.0e-02 7aor-assembly1_an mt-SSU from Trypanosoma cruzi in complex with mt-IF-3.
3f42-assembly1_A-2 0.98 0.75 1.4e-01 3f42-assembly1_A-2 Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
1j8b-assembly1_A-2 0.97 0.76 2.0e-01 1j8b-assembly1_A-2 Structure of YbaB from Haemophilus influenzae (HI0442), a protein of unknown function
3f42-assembly1_B-2 0.96 0.76 2.0e-01 3f42-assembly1_B-2 Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
1ybx-assembly1_A 0.90 0.71 2.7e-01 1ybx-assembly1_A Conserved hypothetical protein Cth-383 from Clostridium thermocellum
1pug-assembly1_A 0.87 0.60 1.5e-01 1pug-assembly1_A Structure of E. coli Ybab
1pug-assembly1_B 0.85 0.68 2.6e-01 1pug-assembly1_B Structure of E. coli Ybab
1pug-assembly2_D 0.75 0.69 5.1e-01 1pug-assembly2_D Structure of E. coli Ybab

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0023 (transcriptional regulator), medium confidence from genomic context alone (score 670 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0027 hyp hypothetical protein 932 933 ctx neighborhood:881 coexpression:458
Rv0029 hyp hypothetical protein 730 731 ctx neighborhood:728
Rv0023 transcriptional regulator 670 670 ctx neighborhood:670
Rv0025 hyp hypothetical protein 661 661 ctx neighborhood:660
Rv0022c whiB5 transcriptional regulator WhiB5 641 641 ctx neighborhood:638
Rv0026 hyp hypothetical protein 535 534 ctx neighborhood:528
Rv0030 hyp hypothetical protein 443 443 ctx neighborhood:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: ESX-1 secretion-associated protein EspH, TM 0.61, E 1e-3
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

ESM Atlas signal (exploratory)

Ancestral protein hash 7d0c86be9dfc224ecfe16be7a29e515d · 3 ESM-space neighbours (max similarity 0.720). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
116353 0.71 Acidic catalytic motifs and coiled-coils
2407 0.64 Disordered pre-sequences and tails
38645 0.61 Charged C-terminal helical tails
48723 0.56 Cofactor-anchoring helix-loop caps
57936 0.53 Cofactor-binding beta-loop patches
612593 0.47 Disordered low-complexity regulatory tails
74679 0.47 Active-site gating segments
89873 0.46 Cys/Sec-centered redox/cofactor loops

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214542.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2694 (PF10904.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AUU9
  • Curated reference: UniProt P9WM97 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 76.7, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor Rv0023
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000033|Rv0028|
MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLAEAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR