Rv0036c Family assigned · medium
H37Rv Rv0036c · MTBC0 mtbc0_000041 ·
257 aa ·
39155–39928 MTBC0
(-) ·
RefSeq NP_214550.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | TIGR03084 family metal-binding protein |
| Revised (this work) | Putative DinB/YfiT-like metal-dependent enzyme (Pfam DinB_2 PF12867, with MDMPI_N PF11716). The DinB superfamily is a versatile metal-binding four-helix bundle; PGAP annotates a TIGR03084-family metal-binding protein. Distinct from the Y-family DNA polymerases DinB1/DinB2 (Rv1537/Rv3056); the specific catalytic activity of Rv0036c is not established. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) 2 publications
Found under: H37Rv (2).
2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Genome-Wide Study of Drug Resistant Mycobacterium tuberculosis and Its Intra-Host Evolution during Treatment. doi:10.3390/microorganisms10071440 | 2022 |
| Analysis of intracellular expressed proteins of Mycobacterium tuberculosis clinical isolates. doi:10.1186/1477-5956-10-14 | 2012 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.22 (95% CI -0.52 to 3.99). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0037c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0051
· 82.1% identity |
| M. smegmatis |
MSMEG_6923
· 75.4% identity |
| M. orygis |
RJtmp_000041
· 100.0% identity |
| M. abscessus |
MAB_4930
· 68.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WM91
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0036c |
UniProt still lists this protein as Uncharacterized protein Rv0036c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Wyosine base formation |
| Orthologous group | 28HG7 |
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.663 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 8 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 1.35% of strains (1957) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 81.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 62.4% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 155. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 571.0 ppm · rank 366/3519 (89.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 257 aa |
|---|---|
| Molecular weight | 27.5 kDa |
| Theoretical pI | 4.84 |
| GRAVY | -0.051 (hydrophilic) |
| Aliphatic index | 86.8 |
| Aromaticity | 0.074 |
| Instability index | 30.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MDMPI_N | PF11716.14 | 3.7e-31 | 11–147 | Mycothiol maleylpyruvate isomerase N-terminal domain |
DinB_2 | PF12867.13 | 1.8e-08 | 12–142 | DinB superfamily |
Wyosine_form | PF08608.18 | 7.3e-11 | 183–226 | Wyosine base formation |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2nsg-assembly1_A |
1.00 | 0.65 | 5.2e-08 sig | 2nsg-assembly1_A Crystal structure of the mycothiol-dependent maleylpyruvate isomerase H52A mutant |
2nsf-assembly1_A |
1.00 | 0.64 | 4.7e-08 sig | 2nsf-assembly1_A Crystal structure of the mycothiol-dependent maleylpyruvate isomerase |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | fadD34 (+ strand, 108 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0037c (- strand, 47 bp gap) |
| Predicted operon |
Rv0036c · Rv0037c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv0037c (MFS-type transporter), high confidence from genomic context alone (score 819 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0037c |
MFS-type transporter | 818 | 819 ctx | neighborhood:816 |
Rv0038 hyp |
hypothetical protein | 739 | 739 ctx | neighborhood:738 |
Rv0976c hyp |
hypothetical protein | 700 | 701 ctx | cooccurence:628 |
Rv0972c fadE12 |
acyl-CoA dehydrogenase fadE12 | 527 | 527 ctx | cooccurence:511 |
Rv2778c hyp |
hypothetical protein | 524 | 524 ctx | cooccurence:515 |
Rv0876c |
transmembrane protein | 517 | 517 ctx | cooccurence:514 |
Rv2912c |
TetR family HTH-type transcriptional regulator | 403 | 403 | |
Rv0931c pknD |
serine/threonine-protein kinase PknD | 546 | 53 | textmining:541 |
Rv0831c hyp |
hypothetical protein | 870 | 47 | textmining:870 |
Rv0941c hyp |
hypothetical protein | 868 | 47 | textmining:868 |
Rv0014c pknB |
serine/threonine-protein kinase PknB | 434 | 44 | textmining:433 |
Rv1507c hyp |
hypothetical protein | 437 | 42 | textmining:437 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: 'TIGR03084 family metal-binding protein'
- Pfam: MDMPI_N PF11716 (E=3.7e-31), DinB_2 PF12867 (E=1.8e-08), Wyosine_form PF08608 (E=7.3e-11) -- DinB-like metal-binding fold
- DinB family = metal-binding 4-helix bundle, enzymatically versatile; Rv0036c is NOT one of the characterised DinB DNA polymerases (Rv1537/Rv3056)
ESM Atlas signal (exploratory)
Ancestral protein hash db392d22b8c76b01f6c8aaf80c6e9232 ·
10 ESM-space neighbours (max similarity 0.910).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 16286 |
1.00 | Noncatalytic redox interfaces |
| 2 | 593 |
0.99 | Active-site metal-proximal helices |
| 3 | 4375 |
0.93 | Charged helix-capping pocket loop |
| 4 | 4851 |
0.87 | Amphipathic C-terminal interaction surfaces |
| 5 | 6050 |
0.86 | Aromatic–glycine hotspot motif |
| 6 | 3853 |
0.85 | Acidic amphipathic helix nucleators |
| 7 | 12426 |
0.69 | Active-site-adjacent scaffolding segments |
| 8 | 4287 |
0.66 | Non-heme diiron helical scaffolds |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214550.1)
- Domains: Pfam-A via hmmscan --cut_ga — MDMPI_N (PF11716.14), DinB_2 (PF12867.13), Wyosine_form (PF08608.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
28HG7 - Curated reference: UniProt P9WM91 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
Rv0037c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000041|Rv0036c| MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQIGHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRGRLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSIAHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVTQRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0036c? Email the maintainer — the message is pre-filled with this gene's details.