Rv0036c Family assigned · medium

H37Rv Rv0036c · MTBC0 mtbc0_000041 · 257 aa · 39155–39928 (-) · RefSeq NP_214550.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTIGR03084 family metal-binding protein
Revised (this work)Putative DinB/YfiT-like metal-dependent enzyme (Pfam DinB_2 PF12867, with MDMPI_N PF11716). The DinB superfamily is a versatile metal-binding four-helix bundle; PGAP annotates a TIGR03084-family metal-binding protein. Distinct from the Y-family DNA polymerases DinB1/DinB2 (Rv1537/Rv3056); the specific catalytic activity of Rv0036c is not established.

Curated reference (UniProt)

UniProt P9WM91 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0036c

UniProt still lists this protein as Uncharacterized protein Rv0036c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionWyosine base formation
Orthologous group28HG7
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.663 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 8 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 1.35% of strains (1957) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MDMPI_NPF11716.14 3.7e-3111–147 Mycothiol maleylpyruvate isomerase N-terminal domain
DinB_2PF12867.13 1.8e-0812–142 DinB superfamily
Wyosine_formPF08608.18 7.3e-11183–226 Wyosine base formation

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0037c (MFS-type transporter), high confidence from genomic context alone (score 819 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0037c MFS-type transporter 818 819 ctx neighborhood:816
Rv0038 hyp hypothetical protein 739 739 ctx neighborhood:738
Rv0976c hyp hypothetical protein 700 701 ctx cooccurence:628
Rv0972c fadE12 acyl-CoA dehydrogenase fadE12 527 527 ctx cooccurence:511
Rv2778c hyp hypothetical protein 524 524 ctx cooccurence:515
Rv0876c transmembrane protein 517 517 ctx cooccurence:514
Rv2912c TetR family HTH-type transcriptional regulator 403 403
Rv0931c pknD serine/threonine-protein kinase PknD 546 53 textmining:541
Rv0831c hyp hypothetical protein 870 47 textmining:870
Rv0941c hyp hypothetical protein 868 47 textmining:868
Rv0014c pknB serine/threonine-protein kinase PknB 434 44 textmining:433
Rv1507c hyp hypothetical protein 437 42 textmining:437

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'TIGR03084 family metal-binding protein'
  • Pfam: MDMPI_N PF11716 (E=3.7e-31), DinB_2 PF12867 (E=1.8e-08), Wyosine_form PF08608 (E=7.3e-11) -- DinB-like metal-binding fold
  • DinB family = metal-binding 4-helix bundle, enzymatically versatile; Rv0036c is NOT one of the characterised DinB DNA polymerases (Rv1537/Rv3056)

ESM Atlas signal (exploratory)

Ancestral protein hash db392d22b8c76b01f6c8aaf80c6e9232 · 10 ESM-space neighbours (max similarity 0.910). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
116286 1.00 Noncatalytic redox interfaces
2593 0.99 Active-site metal-proximal helices
34375 0.93 Charged helix-capping pocket loop
44851 0.87 Amphipathic C-terminal interaction surfaces
56050 0.86 Aromatic–glycine hotspot motif
63853 0.85 Acidic amphipathic helix nucleators
712426 0.69 Active-site-adjacent scaffolding segments
84287 0.66 Non-heme diiron helical scaffolds

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214550.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MDMPI_N (PF11716.14), DinB_2 (PF12867.13), Wyosine_form (PF08608.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28HG7
  • Curated reference: UniProt P9WM91 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv0037c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000041|Rv0036c|
MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQIGHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRGRLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSIAHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVTQRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR