nuoA Family assigned · medium auto-curated
H37Rv Rv3145 · MTBC0 mtbc0_003343 ·
128 aa · 3534384–3534770 (+) ·
RefSeq NP_217661.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NADH-quinone oxidoreductase subunit A |
|---|---|
| MTBC0 PGAP re-annotation | NADH-quinone oxidoreductase subunit A |
| Revised (this work) | NADH-quinone oxidoreductase subunit A. Pfam: Oxidored_q4 (PF00507.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIW7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | NADH-quinone oxidoreductase subunit A |
| EC (curated) |
EC 7.1.1.-
|
| Curated function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | nuoA |
| eggNOG description | NDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient |
| Orthologous group | COG0838 |
| EC number |
EC 1.6.5.3
|
| KEGG orthology |
K00330
|
| KEGG pathways |
map00190, map01100
|
| KEGG modules |
M00144
|
| Gene Ontology (18) |
GO:0003674, GO:0003824, GO:0003954, GO:0005575, GO:0008137, GO:0008150, GO:0008152, GO:0016020, GO:0016491, GO:0016651, GO:0016655, GO:0030964 +6 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Oxidored_q4 | PF00507.25 | 1.8e-31 | 19–127 | NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: nuoK (NADH-quinone oxidoreductase subunit K), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3155 nuoK |
NADH-quinone oxidoreductase subunit K | 999 | 1000 ctx | neighborhood:762 cooccurence:774 coexpression:979 experimental:997 textmining:625 |
Rv3152 nuoH |
NADH-quinone oxidoreductase subunit H | 999 | 1000 ctx | neighborhood:762 cooccurence:774 coexpression:973 experimental:997 database:803 textmining:689 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 999 | 1000 ctx | neighborhood:762 cooccurence:754 coexpression:979 experimental:928 database:731 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 999 | 1000 ctx | neighborhood:879 cooccurence:762 coexpression:973 experimental:997 database:731 textmining:630 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 999 | 1000 ctx | neighborhood:879 coexpression:937 experimental:928 database:620 textmining:644 |
Rv3158 nuoN |
NADH-quinone oxidoreductase subunit N | 999 | 1000 ctx | neighborhood:758 cooccurence:773 coexpression:943 experimental:997 database:747 textmining:819 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 999 | 1000 ctx | neighborhood:879 cooccurence:765 coexpression:968 experimental:928 database:731 |
Rv3154 nuoJ |
NADH-quinone oxidoreductase subunit J | 999 | 1000 ctx | neighborhood:762 cooccurence:766 coexpression:858 experimental:997 textmining:675 |
Rv3151 nuoG |
NADH-quinone oxidoreductase subunit G | 999 | 1000 ctx | neighborhood:879 coexpression:884 experimental:928 database:583 textmining:662 |
Rv3157 nuoM |
NADH-quinone oxidoreductase subunit M | 999 | 1000 ctx | neighborhood:758 cooccurence:772 coexpression:878 experimental:928 database:803 textmining:685 |
Rv3150 nuoF |
NADH-quinone oxidoreductase subunit F | 999 | 1000 ctx | neighborhood:879 coexpression:927 experimental:928 database:583 textmining:518 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 999 | 1000 ctx | neighborhood:879 cooccurence:769 coexpression:967 experimental:997 database:731 |
Rv3156 nuoL |
NADH-quinone oxidoreductase subunit L | 999 | 999 ctx | neighborhood:758 cooccurence:773 coexpression:851 experimental:928 textmining:625 |
Rv3143 |
response regulator | 998 | 998 ctx | neighborhood:477 experimental:997 |
Rv0310c hyp |
hypothetical protein | 979 | 978 | experimental:928 database:667 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NADH-quinone oxidoreductase subunit A
- MTBC0 PGAP product: NADH-quinone oxidoreductase subunit A
- Pfam (hmmscan --cut_ga): Oxidored_q4 PF00507.25 (E=2e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217661.1)
- Domains: Pfam-A via hmmscan --cut_ga — Oxidored_q4 (PF00507.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0838 - Curated reference: UniProt P9WIW7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
172 functional partner(s); context anchor
nuoK - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003343|Rv3145|nuoA MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGAASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVWRRGGLTWD