Rv0027 Family assigned · medium

H37Rv Rv0027 · MTBC0 mtbc0_000032 · 105 aa · 31175–31492 (+) · RefSeq NP_214541.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationESX-1 secretion-associated protein
Revised (this work)Type VII secretion system (ESX) EspC-family protein. Pfam assigns the T7SS_ESX_EspC domain (PF10824, E=2.2e-31), a more specific call than the PGAP 'ESX-1 secretion-associated protein' label; consistent with a secreted ESX/Esp-associated substrate. No Rv0027-specific experimental characterization was found.

Curated reference (UniProt)

UniProt P9WM99 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0027

UniProt still lists this protein as Uncharacterized protein Rv0027; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionExcreted virulence factor EspC, type VII ESX diderm
Orthologous group2AVCJ

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.915 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
T7SS_ESX_EspCPF10824.15 2.2e-311–98 Excreted virulence factor EspC, type VII ESX diderm

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0023 (transcriptional regulator), medium confidence from genomic context alone (score 670 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0028 hyp hypothetical protein 932 933 ctx neighborhood:881 coexpression:458
Rv0025 hyp hypothetical protein 691 691 ctx neighborhood:690
Rv0023 transcriptional regulator 670 670 ctx neighborhood:670
Rv0029 hyp hypothetical protein 654 653 ctx neighborhood:650
Rv0022c whiB5 transcriptional regulator WhiB5 642 642 ctx neighborhood:638
Rv0026 hyp hypothetical protein 536 536 ctx neighborhood:529
Rv0030 hyp hypothetical protein 436 436 ctx neighborhood:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'ESX-1 secretion-associated protein'
  • Pfam (hmmscan --cut_ga): T7SS_ESX_EspC PF10824 (E=2.2e-31) -- refines the family assignment
  • WebSearch returned no Rv0027-specific functional study (only generic STRING interaction page)

ESM Atlas signal (exploratory)

Ancestral protein hash 57fd3a66830d2f40dae12ce80745d8f5 · 10 ESM-space neighbours (max similarity 0.943). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
18583 0.90 N-terminal secretion helices
211910 0.89 Short amphipathic interaction helix
35992 0.88 Glycine-centered amphipathic helix-turn motifs
42916 0.87 Secretion-targeting helical coiled-coils
55094 0.70 N-terminal secretion-targeting helices
62267 0.67 Pro/Gly-rich low-complexity repeats
712235 0.53 Juxtamembrane coiled-coil assembly
89670 0.52 Elongated amphipathic coiled-coils

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214541.1)
  • Domains: Pfam-A via hmmscan --cut_ga — T7SS_ESX_EspC (PF10824.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AVCJ
  • Curated reference: UniProt P9WM99 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor Rv0023
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000032|Rv0027|
MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGPIFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGSR