Rv0027 Family assigned · medium
H37Rv Rv0027 · MTBC0 mtbc0_000032 ·
105 aa · 31175–31492 (+) ·
RefSeq NP_214541.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | ESX-1 secretion-associated protein |
| Revised (this work) | Type VII secretion system (ESX) EspC-family protein. Pfam assigns the T7SS_ESX_EspC domain (PF10824, E=2.2e-31), a more specific call than the PGAP 'ESX-1 secretion-associated protein' label; consistent with a secreted ESX/Esp-associated substrate. No Rv0027-specific experimental characterization was found. |
Curated reference (UniProt)
| UniProt |
P9WM99
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv0027 |
UniProt still lists this protein as Uncharacterized protein Rv0027; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Excreted virulence factor EspC, type VII ESX diderm |
| Orthologous group | 2AVCJ |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.915 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
T7SS_ESX_EspC | PF10824.15 | 2.2e-31 | 1–98 | Excreted virulence factor EspC, type VII ESX diderm |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0023 (transcriptional regulator), medium confidence from genomic context alone (score 670 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0028 hyp |
hypothetical protein | 932 | 933 ctx | neighborhood:881 coexpression:458 |
Rv0025 hyp |
hypothetical protein | 691 | 691 ctx | neighborhood:690 |
Rv0023 |
transcriptional regulator | 670 | 670 ctx | neighborhood:670 |
Rv0029 hyp |
hypothetical protein | 654 | 653 ctx | neighborhood:650 |
Rv0022c whiB5 |
transcriptional regulator WhiB5 | 642 | 642 ctx | neighborhood:638 |
Rv0026 hyp |
hypothetical protein | 536 | 536 ctx | neighborhood:529 |
Rv0030 hyp |
hypothetical protein | 436 | 436 ctx | neighborhood:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: 'ESX-1 secretion-associated protein'
- Pfam (hmmscan --cut_ga): T7SS_ESX_EspC PF10824 (E=2.2e-31) -- refines the family assignment
- WebSearch returned no Rv0027-specific functional study (only generic STRING interaction page)
ESM Atlas signal (exploratory)
Ancestral protein hash 57fd3a66830d2f40dae12ce80745d8f5 ·
10 ESM-space neighbours (max similarity 0.943).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 8583 |
0.90 | N-terminal secretion helices |
| 2 | 11910 |
0.89 | Short amphipathic interaction helix |
| 3 | 5992 |
0.88 | Glycine-centered amphipathic helix-turn motifs |
| 4 | 2916 |
0.87 | Secretion-targeting helical coiled-coils |
| 5 | 5094 |
0.70 | N-terminal secretion-targeting helices |
| 6 | 2267 |
0.67 | Pro/Gly-rich low-complexity repeats |
| 7 | 12235 |
0.53 | Juxtamembrane coiled-coil assembly |
| 8 | 9670 |
0.52 | Elongated amphipathic coiled-coils |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214541.1)
- Domains: Pfam-A via hmmscan --cut_ga — T7SS_ESX_EspC (PF10824.15)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AVCJ - Curated reference: UniProt P9WM99 (SwissProt, reviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
7 functional partner(s); context anchor
Rv0023 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000032|Rv0027| MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGPIFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGSR