Rv0030 Family assigned · medium

H37Rv Rv0030 · MTBC0 mtbc0_000036 · 109 aa · 33210–33539 MTBC0 (+) · RefSeq NP_214544.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand rodA (Rv0017c) — requalified: cell shape-determining peptidoglycan glycosyltransferase Rod fhaB (Rv0019c) — family_assigned: FHA domain-containing protein fhaA (Rv0020c) — requalified: cell division-associated protein FhaA fhaA Rv0021c (Rv0021c) — family_assigned: nitronate monooxygenase family protein Rv0021c whiB5 (Rv0022c) — family_assigned: transcriptional regulator WhiB5 Rv0023 (Rv0023) — family_assigned: helix-turn-helix transcriptional regulator Rv0024 (Rv0024) — family_assigned: C40 family peptidase Rv0024 Rv0025 (Rv0025) — dark: DUF4226 domain-containing protein Rv0027 (Rv0027) — family_assigned: ESX-1 secretion-associated protein Rv0028 (Rv0028) — family_assigned: DUF2694 domain-containing protein Rv0029 (Rv0029) — dark: DUF5631 domain-containing protein Rv0029 Rv0030 (Rv0030) — family_assigned: DUF2710 domain-containing protein bioF2 (Rv0032) — family_assigned: pyridoxal phosphate-dependent aminotransferase family protei bioF2 acpA (Rv0033) — requalified: acyl carrier protein Rv0034 (Rv0034) — family_assigned: nuclear transport factor 2 family protein Rv0036c (Rv0036c) — family_assigned: TIGR03084 family metal-binding protein Rv0037c (Rv0037c) — requalified: MFS transporter Rv0037c Rv0038 (Rv0038) — family_assigned: YqgE/AlgH family protein Rv0039c (Rv0039c) — dark: hypothetical protein mtc28 (Rv0040c) — family_assigned: LpqN/LpqT family lipoprotein mtc28 leuS (Rv0041) — requalified: leucine--tRNA ligase leuS 24 kb 28 kb 32 kb 36 kb 40 kb 44 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF2710 domain-containing protein
Revised (this work)YbaB/EbfC-family nucleoid-associated protein (DNA-binding): HHpred matches the YbaB/EbfC fold with high confidence (99.7%, E1.7e-15), including the CHARACTERISED M. tuberculosis YbaB/EbfC nucleoid-associated protein Rv3716c (99.66%, E4e-15) and the founding YbaB (1J8B, E3.2e-14). Rv0030 is thus a paralog of Rv3716c; YbaB/EbfC proteins are nucleoid-associated DNA-binding proteins involved in nucleoid organisation / gene regulation. The specific regulatory role of this paralog is undetermined. RefSeq leaves this locus uncharacterised.
Functional category (TubercuList)conserved hypotheticals

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder16% of residues (metapredict) · mean AlphaFold pLDDT 84.9
Disordered regions1 IDR(s), longest 17 aa [0-17]

carries a substantial disordered region (17/109 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 1.03 (95% CI -0.69 to 4.08). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0031 · 100.0% identity
M. marinum MMAR_0049 · 78.9% identity
M. orygis RJtmp_000036 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WM95 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0030

UniProt still lists this protein as Uncharacterized protein Rv0030; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2710)
Orthologous group2AVE0

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.176 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 45/53 (85%) · mean identity 77.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 45/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RDcap_Spain1 100% Caprae

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 92.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 6 of 16 independent MS datasets
Integrated abundance22.8 ppm · rank 2253/3519 (36.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length109 aa
Molecular weight11.9 kDa
Theoretical pI4.53
GRAVY-0.371 (hydrophilic)
Aliphatic index93.9
Aromaticity0.037
Instability index24.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2710PF10921.15 2.8e-516–106 Protein of unknown function (DUF2710)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 64.7 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3f42-assembly1_B-2 1.00 0.70 4.0e-03 sig 3f42-assembly1_B-2 Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
7ane-assembly1_an 1.00 0.67 3.5e-03 sig 7ane-assembly1_an Leishmania Major mitochondrial ribosome
3f42-assembly1_A-2 1.00 0.65 4.5e-03 sig 3f42-assembly1_A-2 Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
1pug-assembly2_D 1.00 0.76 3.8e-02 1pug-assembly2_D Structure of E. coli Ybab
1pug-assembly1_A 1.00 0.73 5.6e-02 1pug-assembly1_A Structure of E. coli Ybab
7pua-assembly1_DK 1.00 0.76 6.7e-02 7pua-assembly1_DK Middle assembly intermediate of the Trypanosoma brucei mitoribosomal small subunit
1j8b-assembly1_A-2 1.00 0.52 1.1e-02 1j8b-assembly1_A-2 Structure of YbaB from Haemophilus influenzae (HI0442), a protein of unknown function
1pug-assembly2_C 1.00 0.67 3.8e-02 1pug-assembly2_C Structure of E. coli Ybab

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 84.9

PDB hitprobTM-scoreE-valueDescription
3f42-assembly1_B-2 1.00 0.65 9.2e-03 sig 3f42-assembly1_B-2 Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
3f42-assembly1_A-2 1.00 0.62 8.1e-03 sig 3f42-assembly1_A-2 Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
1j8b-assembly1_A-2 1.00 0.51 8.1e-03 sig 1j8b-assembly1_A-2 Structure of YbaB from Haemophilus influenzae (HI0442), a protein of unknown function

Foldseek search of the AlphaFold DB model (mean pLDDT 84.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0029 (+ strand, 69 bp gap)
Downstream (3' on genome)bioF2 (+ strand, 741 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) whiB5 (activates) · Rv2034 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0031 (Rv0031, (MTCY10H4.31), len: 70 aa. Possible remnant of a transposase, showing partial similarity to mycobacterial transposases in a short ov), medium confidence from genomic context alone (score 693 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0029 hyp hypothetical protein 798 798 ctx neighborhood:792
Rv0031 Rv0031, (MTCY10H4.31), len: 70 aa. Possible remnant of a transposase, showing partial similarity to mycobacterial transposases in a short ov 693 693 ctx neighborhood:678
Rv3894c eccC2 ESX-2 type VII secretion system protein EccC 550 551 ctx neighborhood:544
Rv0028 hyp hypothetical protein 443 443 ctx neighborhood:439
Rv0027 hyp hypothetical protein 436 436 ctx neighborhood:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred (significant): top hits HP0035 99.7% E1.7e-15, conserved hypothetical 99.66% E5.7e-15, M.tb nucleoid-associated protein Rv3716c (5YRX) 99.66% E4e-15, YbaB/EbfC 1J8B 99.63% E3.2e-14 = confident YbaB/EbfC fold. Rv0030 = second YbaB/EbfC paralog in M.tb (Rv3716c is the characterised one). DUF2710. Nucleoid-associated DNA-binding family.
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

ESM Atlas signal (exploratory)

Ancestral protein hash c01c0c8f293e2bde8e36ce6f95f91491 · 1 ESM-space neighbours (max similarity 0.646). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
116353 0.61 Acidic catalytic motifs and coiled-coils
214146 0.50 Edge beta-hairpin interaction loops
38624 0.47 Presequence-to-core transition helix
47936 0.47 Cofactor-binding beta-loop patches
514653 0.47 Charged coiled-coil stalk helices
613240 0.46 Amphipathic core helices
7407 0.46 Disordered pre-sequences and tails
812593 0.46 Disordered low-complexity regulatory tails

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214544.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2710 (PF10921.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AVE0
  • Curated reference: UniProt P9WM95 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 64.7, low)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 84.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor Rv0031
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000036|Rv0030|
MVSGSDSRSEPSQLSDRDLVESVLRDLSEAADKWEALVTQAETVTYSVDLGDVRAVANSDGRLLELTLHPGVMTGYAHGELADRVNLAITALRDEVEAENRARYGGRLQ