accD4 Family assigned · medium auto-curated
H37Rv Rv3799c · MTBC0 mtbc0_004027 ·
522 aa · 4278490–4280058 (-) ·
RefSeq NP_218316.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | propionyl-CoA carboxylase subunit beta AccD |
|---|---|
| MTBC0 PGAP re-annotation | acyl-CoA carboxylase subunit beta |
| Revised (this work) | Acyl-CoA carboxylase subunit beta. Pfam: Carboxyl_trans (PF01039.28), ACCA (PF03255.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53578
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Biotin-dependent long chain acyl-coenzyme A carboxylase beta4 subunit |
| EC (curated) |
EC 2.1.3.-
|
| Curated function | Component of a biotin-dependent acyl-CoA carboxylase complex. This subunit transfers the CO2 from carboxybiotin to the CoA ester substrate. When associated with the alpha3 subunit AccA3, the beta5 subunit AccD5 and the epsilon subunit AccE5, forms the LCC complex, which is involved in the carboxylation of long chain acyl-CoA. The LCC complex can use C16-C24 substrates, the highest specific activity is obtained with carboxy-C20-CoA. Has low activity with acetyl-CoA and propionyl-CoA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | accD4 |
| eggNOG description | Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) |
| Orthologous group | COG4799 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.272 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Carboxyl_trans | PF01039.28 | 9.1e-143 | 39–519 | Carboxyl transferase domain |
ACCA | PF03255.20 | 4.6e-11 | 306–448 | Acetyl co-enzyme A carboxylase carboxyltransferase-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pks13 (polyketide synthase), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3800c pks13 |
polyketide synthase | 996 | 976 ctx | neighborhood:881 coexpression:810 textmining:864 |
Rv3285 accA3 |
bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA | 998 | 974 | coexpression:466 experimental:454 database:877 textmining:945 |
Rv3801c fadD32 |
long-chain-fatty-acid--AMP ligase FadD32 | 997 | 974 ctx | neighborhood:881 coexpression:761 textmining:924 |
Rv0973c accA2 |
acetyl/propionyl-CoA carboxylase subuit alpha | 940 | 888 | coexpression:437 experimental:454 database:578 textmining:492 |
Rv2501c accA1 |
acetyl/propionyl-CoA carboxylase subuit alpha | 948 | 886 | coexpression:437 experimental:454 database:578 textmining:566 |
Rv2247 accD6 |
acetyl-/propionyl-CoA carboxylase subunit beta | 897 | 886 | coexpression:533 database:720 |
Rv3281 accE5 |
bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE | 897 | 754 | database:720 textmining:601 |
Rv3279c birA |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 812 | 749 | database:622 |
Rv3280 accD5 |
propionyl-CoA carboxylase subunit beta | 872 | 741 | database:720 textmining:528 |
Rv1630 rpsA |
30S ribosomal protein S1 | 739 | 739 | coexpression:731 |
Rv3802c |
membrane protein | 815 | 725 ctx | neighborhood:719 |
Rv2245 kasA |
3-oxoacyl-ACP synthase 1 | 767 | 713 | coexpression:703 |
Rv2967c pca |
pyruvate carboxylase | 714 | 697 | database:576 |
Rv3221c TB7.3 |
acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | 705 | 688 | database:576 |
Rv1322A hyp |
hypothetical protein | 686 | 671 ctx | cooccurence:604 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: propionyl-CoA carboxylase subunit beta AccD
- MTBC0 PGAP product: acyl-CoA carboxylase subunit beta
- Pfam (hmmscan --cut_ga): Carboxyl_trans PF01039.28 (E=9e-143), ACCA PF03255.20 (E=5e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218316.2)
- Domains: Pfam-A via hmmscan --cut_ga — Carboxyl_trans (PF01039.28), ACCA (PF03255.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4799 - Curated reference: UniProt O53578 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
pks13 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004027|Rv3799c|accD4 MTVTEPVLHTTAEKLAELRERLELAKEPGGEKAAAKRDKKGIPSARARIYELVDPGSFMEIGALCRTPGDPNALYGDGVVTGHGLINGRPVGVFSHDQTVFGGTVGEMFGRKVARLMEWCAMVGCPIVGINDSGGARIQDAVTSLAWYAELGRRHELLSGLVPQISIILGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGPDVIKDVTGEDVSLDELGGADHQASYGNIHQVVESEAAAYQYVRDFLSFLPSNCFDKPPVVNPGLEPEITGHDLELDSIVPDSDNMAYDMHEVLLRIFDDGDFLDVAAQAGQAIITGYARVDGRTVGVVANQPMHMSGAIDNEASDKAARFIRFSDAFDIPLVFVVDTPGFLPGVEQEKNGIIKRGGRFLYAVVEADVPKVTITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGADGAAQLLMKRFPDPNAPEAQAIRKSFVENYNLNMAIPWIAAERGFIDAVIDPHETRLLLRKSMHLLRDKQLWWRVGRKHGLIPV