accD4 Family assigned · medium auto-curated
H37Rv Rv3799c · MTBC0 mtbc0_004027 ·
522 aa ·
4278490–4280058 MTBC0
(-) ·
RefSeq NP_218316.2
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | propionyl-CoA carboxylase subunit beta AccD |
|---|---|
| MTBC0 PGAP re-annotation | acyl-CoA carboxylase subunit beta |
| Revised (this work) | Acyl-CoA carboxylase subunit beta. Pfam: Carboxyl_trans (PF01039.28), ACCA (PF03255.20). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 14 publications
14 TB publications mention this gene. 14 publication(s) discuss this gene (14 in a M. tuberculosis context, 8 in other mycobacteria — M. smegmatis (5), M. leprae (3)).
| Publication | Date |
|---|---|
| Architecture of an asymmetric short chain/long chain hybrid acyl‑CoA carboxylase from Mycobacterium smegmatis. doi:10.1038/s42003-026-10439-x | 2026 |
| Structural basis for substrate specificity and MSMEG_0435-0436 binding by the mycobacterial long-chain acyl-CoA carboxylase complex. doi:10.1073/pnas.2530575123 | 2026 |
| Mycobacterium smegmatis PrrAB two-component system influences triacylglycerol accumulation during ammonium stress. doi:10.1099/mic.0.000705 | 2018 |
| Identification of Novel Coumestan Derivatives as Polyketide Synthase 13 Inhibitors against Mycobacterium tuberculosis. doi:10.1021/acs.jmedchem.7b01319 | 2018 |
| Functional reconstitution of the Mycobacterium tuberculosis long-chain acyl-CoA carboxylase from multiple acyl-CoA subunits. doi:10.1111/febs.14046 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | pks13 (Rv3800c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -9.27 (95% CI -10.35 to -8.19). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Key enzyme in the catabolic pathway of odd-chain fatty acids, isoleucine, threonine, methionine, and valine [catalytic activity: ATP + propionyl-CoA + CO(2) + H(2)O = ADP + orthophosphate + methylmalonyl-CoA.] |
|---|---|
| Mycobrowser EC |
6.4.1.3
· differs from the atlas (2.1.3.-) — AccD4: Mycobrowser gives the holoenzyme (propionyl-CoA carboxylase 6.4.1.3), the atlas the carboxyltransferase subunit (2.1.3.-)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3829c
· 99.8% identity |
|---|---|
| M. leprae |
ML0102
· 91.1% identity |
| M. marinum |
MMAR_5363
· 90.5% identity |
| M. smegmatis |
MSMEG_6391
· 81.5% identity |
| M. orygis |
RJtmp_003911
· 99.8% identity |
| M. abscessus |
MAB_0181
· 75.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53578
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Biotin-dependent long chain acyl-coenzyme A carboxylase beta4 subunit |
| EC (curated) |
EC 2.1.3.-
|
| Curated function | Component of a biotin-dependent acyl-CoA carboxylase complex. This subunit transfers the CO2 from carboxybiotin to the CoA ester substrate. When associated with the alpha3 subunit AccA3, the beta5 subunit AccD5 and the epsilon subunit AccE5, forms the LCC complex, which is involved in the carboxylation of long chain acyl-CoA. The LCC complex can use C16-C24 substrates, the highest specific activity is obtained with carboxy-C20-CoA. Has low activity with acetyl-CoA and propionyl-CoA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | accD4 |
| eggNOG description | Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) |
| Orthologous group | COG4799 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.272 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.326 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 87.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 56.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 18 in the ORF — 17 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.056, mean read count 116. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 266.0 ppm · rank 701/3519 (80.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 522 aa |
|---|---|
| Molecular weight | 56.7 kDa |
| Theoretical pI | 5.33 |
| GRAVY | -0.046 (hydrophilic) |
| Aliphatic index | 93.0 |
| Aromaticity | 0.077 |
| Instability index | 27.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Carboxyl_trans | PF01039.28 | 9.1e-143 | 39–519 | Carboxyl transferase domain |
ACCA | PF03255.20 | 4.6e-11 | 306–448 | Acetyl co-enzyme A carboxylase carboxyltransferase-like |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3iav-assembly1_A |
1.00 | 0.96 | 4.1e-70 sig | 3iav-assembly1_A Propionyl-CoA Carboxylase Beta Subunit, D422V |
3ib9-assembly1_A |
1.00 | 0.96 | 6.5e-69 sig | 3ib9-assembly1_A Propionyl-CoA Carboxylase Beta Subunit, D422L |
1xnv-assembly1_A |
1.00 | 0.95 | 4.9e-69 sig | 1xnv-assembly1_A Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #1 |
1xnw-assembly1_E |
1.00 | 0.96 | 1.8e-67 sig | 1xnw-assembly1_E Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #2, mutant D422I |
3mfm-assembly1_E |
1.00 | 0.95 | 7.9e-67 sig | 3mfm-assembly1_E Crystal Structures and Mutational Analyses of Acyl-CoA Carboxylase Subunit of Streptomyces coelicolor |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv3798 (+ strand, 52 bp gap) |
|---|---|
| Downstream (3' on genome) | pks13 (- strand, -4 bp gap) |
| Predicted operon |
accD4 · pks13 · fadD32
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pks13 (polyketide synthase), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3800c pks13 |
polyketide synthase | 996 | 976 ctx | neighborhood:881 coexpression:810 textmining:864 |
Rv3285 accA3 exp |
bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA | 998 | 974 | coexpression:466 experimental:454 database:877 textmining:945 |
Rv3801c fadD32 |
long-chain-fatty-acid--AMP ligase FadD32 | 997 | 974 ctx | neighborhood:881 coexpression:761 textmining:924 |
Rv0973c accA2 exp |
acetyl/propionyl-CoA carboxylase subuit alpha | 940 | 888 | coexpression:437 experimental:454 database:578 textmining:492 |
Rv2501c accA1 exp |
acetyl/propionyl-CoA carboxylase subuit alpha | 948 | 886 | coexpression:437 experimental:454 database:578 textmining:566 |
Rv2247 accD6 exp |
acetyl-/propionyl-CoA carboxylase subunit beta | 897 | 886 | coexpression:533 database:720 |
Rv3281 accE5 exp |
bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE | 897 | 754 | database:720 textmining:601 |
Rv3279c birA exp |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 812 | 749 | database:622 |
Rv3280 accD5 exp |
propionyl-CoA carboxylase subunit beta | 872 | 741 | database:720 textmining:528 |
Rv1630 rpsA |
30S ribosomal protein S1 | 739 | 739 | coexpression:731 |
Rv3802c |
membrane protein | 815 | 725 ctx | neighborhood:719 |
Rv2245 kasA |
3-oxoacyl-ACP synthase 1 | 767 | 713 | coexpression:703 |
Rv2967c pca exp |
pyruvate carboxylase | 714 | 697 | database:576 |
Rv3221c TB7.3 exp |
acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | 705 | 688 | database:576 |
Rv1322A hyp |
hypothetical protein | 686 | 671 ctx | cooccurence:604 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: propionyl-CoA carboxylase subunit beta AccD
- MTBC0 PGAP product: acyl-CoA carboxylase subunit beta
- Pfam (hmmscan --cut_ga): Carboxyl_trans PF01039.28 (E=9e-143), ACCA PF03255.20 (E=5e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218316.2)
- Domains: Pfam-A via hmmscan --cut_ga — Carboxyl_trans (PF01039.28), ACCA (PF03255.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4799 - Curated reference: UniProt O53578 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
pks13 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004027|Rv3799c|accD4 MTVTEPVLHTTAEKLAELRERLELAKEPGGEKAAAKRDKKGIPSARARIYELVDPGSFMEIGALCRTPGDPNALYGDGVVTGHGLINGRPVGVFSHDQTVFGGTVGEMFGRKVARLMEWCAMVGCPIVGINDSGGARIQDAVTSLAWYAELGRRHELLSGLVPQISIILGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGPDVIKDVTGEDVSLDELGGADHQASYGNIHQVVESEAAAYQYVRDFLSFLPSNCFDKPPVVNPGLEPEITGHDLELDSIVPDSDNMAYDMHEVLLRIFDDGDFLDVAAQAGQAIITGYARVDGRTVGVVANQPMHMSGAIDNEASDKAARFIRFSDAFDIPLVFVVDTPGFLPGVEQEKNGIIKRGGRFLYAVVEADVPKVTITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGADGAAQLLMKRFPDPNAPEAQAIRKSFVENYNLNMAIPWIAAERGFIDAVIDPHETRLLLRKSMHLLRDKQLWWRVGRKHGLIPV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for accD4? Email the maintainer — the message is pre-filled with this gene's details.