Rv1871c Family assigned · medium auto-curated

H37Rv Rv1871c · MTBC0 mtbc0_001984 · 129 aa · 2139534–2139923 (-) · RefSeq NP_216387.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnitroreductase family deazaflavin-dependent oxidoreductase
Revised (this work)Nitroreductase family deazaflavin-dependent oxidoreductase. Pfam: F420H2_quin_red (PF04075.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95144 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionF420H(2)-dependent quinone reductase
Orthologous groupCOG1902

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.683 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
F420H2_quin_redPF04075.21 1.7e-398–128 F420H(2)-dependent quinone reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lldD2 (L-lactate dehydrogenase), high confidence from genomic context alone (score 964 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1872c lldD2 L-lactate dehydrogenase 965 964 ctx neighborhood:750 coexpression:862
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 848 843 coexpression:811
Rv1870c hyp hypothetical protein 814 815 ctx neighborhood:799
Rv3583c carD RNA polymerase-binding transcription factor CarD 800 800 coexpression:800
Rv0685 tuf elongation factor Tu 754 755 coexpression:754
Rv3648c cspA cold shock protein A 738 739 coexpression:739
Rv1793 esxN ESAT-6 like protein EsxN 732 732 coexpression:732
Rv1630 rpsA 30S ribosomal protein S1 732 732 coexpression:732
Rv2346c esxO ESAT-6 like protein EsxO 730 730 coexpression:730
Rv1869c reductase 734 724 ctx neighborhood:720
Rv1919c hyp hypothetical protein 721 721 ctx cooccurence:718
Rv0180c transmembrane protein 609 610 ctx cooccurence:597
Rv1873 hyp hypothetical protein 556 556 ctx neighborhood:556
Rv0703 rplW 50S ribosomal protein L23 540 540 coexpression:533
Rv1546 hyp hypothetical protein 530 530 ctx cooccurence:526

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nitroreductase family deazaflavin-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): F420H2_quin_red PF04075.21 (E=2e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216387.1)
  • Domains: Pfam-A via hmmscan --cut_ga — F420H2_quin_red (PF04075.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1902
  • Curated reference: UniProt P95144 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor lldD2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001984|Rv1871c|
MNAAMNLKREFVHRVQRFVVNPIGRQLPMTMLETIGRKTGQPRRTAVGGRVVDNQFWMVSEHGEHSDYVYNIKANPAVRVRIGGRWRSGTAYLLPDDDPRQRLRGLPRLNSAGVRAMGTDLLTIRVDLD