Rv1313c Family assigned · medium auto-curated

H37Rv Rv1313c · MTBC0 mtbc0_000786 · 107 aa · 836720–837043 (+) · RefSeq NP_215829.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)insertion sequence element IS1557 transposase
MTBC0 PGAP re-annotationtransposase
Revised (this work)ISL3-like element IS1557 family transposase. Pfam: Zn_ribbon_ISL3 (PF14690.12), HTH_Tnp_ISL3 (PF13542.13), DDE_Tnp_ISL3 (PF01610.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKH7 SwissProt · reviewed · Inferred from homology
UniProt nameTransposase for insertion sequence element IS1557

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionTransposase
Orthologous groupCOG3464
KEGG orthology K07485

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.687 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Zn_ribbon_ISL3PF14690.12 8.4e-1247–92 zinc-finger of transposase IS204/IS1001/IS1096/IS1165
HTH_Tnp_ISL3PF13542.13 2.3e-1298–147 Helix-turn-helix domain of transposase family ISL3
DDE_Tnp_ISL3PF01610.24 6.3e-05163–193 Transposase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3428c (transposase), medium confidence from genomic context alone (score 476 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3798 insertion sequence element IS1557 transposase 739 739 coexpression:738
Rv3428c transposase 475 476 ctx cooccurence:464
Rv1314c cob(I)yrinic acid a,c-diamide adenosyltransferase 469 469 ctx neighborhood:467
Rv2737A Rv2737A, len: 57 aa. Conserved hypothetical cys-rich protein (possibly gene fragment), similar to central part of AJ243803_1|glgA from Strep 425 426 ctx cooccurence:419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: insertion sequence element IS1557 transposase
  • MTBC0 PGAP product: ISL3-like element IS1557 family transposase
  • Pfam (hmmscan --cut_ga): Zn_ribbon_ISL3 PF14690.12 (E=8e-12), HTH_Tnp_ISL3 PF13542.13 (E=2e-12), DDE_Tnp_ISL3 PF01610.24 (E=6e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215829.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Zn_ribbon_ISL3 (PF14690.12), HTH_Tnp_ISL3 (PF13542.13), DDE_Tnp_ISL3 (PF01610.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3464
  • Curated reference: UniProt P9WKH7 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor Rv3428c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000786|Rv1313c|
MRQVFSVKGEEGKQALDRWISWARRCRIPVFVELAGGIVRHRQAIDAALDHGLWQGLIESTNTKIRLLTRIAFGFRSPEALIALAMLALGGRRPALPGRTKHPRISQ