whiB4 Family assigned · medium auto-curated

H37Rv Rv3681c · MTBC0 mtbc0_003901 · 118 aa · 4145146–4145502 (-) · RefSeq NP_218198.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator WhiB4
MTBC0 PGAP re-annotationtranscriptional regulator WhiB4
Revised (this work)Transcriptional regulator WhiB4. Pfam: Whib (PF02467.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF39 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulator WhiB4
Curated functionRedox-responsive transcriptional regulator that regulates a set of genes involved in protection against environmental stresses encountered during infection. The loss of the O(2) and NO-responsive 4Fe-4S cluster and subsequent redox modifications of Cys residue thiols (possibly by disulfide bond formation) may activate its role in gene regulation. The thiol-oxidized apo-form binds in a sequence non-specific manner to GC-rich DNA, probably in the minor groove. Represses transcription of a number of genes including itself. The reduced apo-form and holo-form do not bind DNA. The apo-form can act a.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namewhiB4
eggNOG descriptionActs as a transcriptional regulator. Probably redox- responsive. The apo- but not holo-form probably binds DNA
Orthologous group2CC1Y
KEGG orthology K18955
Gene Ontology (33) GO:0003674, GO:0003676, GO:0003677, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0008152, GO:0015036, GO:0016491 +21 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.498 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (189) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WhibPF02467.22 2.7e-2331–93 Transcription factor WhiB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: secG (protein-export membrane protein SecG), high confidence from genomic context alone (score 711 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2584c apt adenine phosphoribosyltransferase 777 768 coexpression:768
Rv1440 secG protein-export membrane protein SecG 711 711 ctx cooccurence:700
Rv2901c hyp hypothetical protein 710 711 ctx cooccurence:709
Rv1830 HTH-type transcriptional regulator 719 708 ctx cooccurence:705
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 707 691 ctx cooccurence:477 experimental:431
Rv0525 hyp hypothetical protein 598 598 ctx cooccurence:596
Rv3221A rshA anti-sigma factor RshA 608 590
Rv1321 nucS endonuclease NucS 585 569 ctx cooccurence:549
Rv1331 clpS ATP-dependent Clp protease adapter protein ClpS 545 545 ctx cooccurence:545
Rv2478c hyp hypothetical protein 538 538 ctx cooccurence:527
Rv3683 hyp hypothetical protein 518 518 ctx neighborhood:416
Rv0736 rslA anti-sigma-L factor RslA 509 486
Rv1222 rseA anti-sigma E factor RseA 496 475
Rv2256c hyp hypothetical protein 474 474 ctx cooccurence:471
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 486 458 experimental:456

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator WhiB4
  • MTBC0 PGAP product: transcriptional regulator WhiB4
  • Pfam (hmmscan --cut_ga): Whib PF02467.22 (E=3e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218198.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Whib (PF02467.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CC1Y
  • Curated reference: UniProt P9WF39 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s); context anchor secG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003901|Rv3681c|whiB4
MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG