Rv3677c Resolved · high auto-curated

H37Rv Rv3677c · MTBC0 mtbc0_003896 · 264 aa · 4141088–4141882 (-) · RefSeq NP_218194.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)beta lactamase
MTBC0 PGAP re-annotationMBL fold metallo-hydrolase
Revised (this work)MBL fold metallo-hydrolase. Pfam: Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14), WHD_BLACT (PF17778.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XHY3 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible hydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namepksB_1
eggNOG descriptionMetallo-beta-lactamase superfamily
Orthologous groupCOG0491

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.556 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.53% of strains (764) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lactamase_BPF00753.34 4.9e-1335–193 Metallo-beta-lactamase superfamily
Lactamase_B_2PF12706.14 2.4e-0653–132 Beta-lactamase superfamily domain
WHD_BLACTPF17778.8 1.2e-05230–261 Beta-lactamase associated winged helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3680 (anion transporter ATPase), high confidence from genomic context alone (score 781 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3678c hyp hypothetical protein 891 891 ctx neighborhood:882
Rv3678A hyp hypothetical protein 869 869 ctx neighborhood:867
Rv3680 anion transporter ATPase 788 781 ctx neighborhood:774
Rv3679 anion transporter ATPase 783 776 ctx neighborhood:774
Rv1561 vapC11 ribonuclease VapC11 765 765 coexpression:765
Rv3040c hyp hypothetical protein 656 656 ctx cooccurence:445
Rv0331 dehydrogenase/reductase 651 636 database:583
Rv2533c nusB N utilization substance protein B 558 558 coexpression:553
Rv1637c hyp hypothetical protein 530 530 ctx cooccurence:529
Rv2260 hyp hypothetical protein 462 463 ctx cooccurence:456
Rv2367c ybeY endoribonuclease 448 421
Rv3455c truA tRNA pseudouridine synthase A 428 407
Rv2165c rsmH rRNA small subunit methyltransferase H 404 405
Rv0337c aspC aspartate aminotransferase 417 396
Rv3674c nth endonuclease III 692 203 textmining:630

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: beta lactamase
  • MTBC0 PGAP product: MBL fold metallo-hydrolase
  • Pfam (hmmscan --cut_ga): Lactamase_B PF00753.34 (E=5e-13), Lactamase_B_2 PF12706.14 (E=2e-06), WHD_BLACT PF17778.8 (E=1e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218194.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lactamase_B (PF00753.34), Lactamase_B_2 (PF12706.14), WHD_BLACT (PF17778.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0491
  • Curated reference: UniProt I6XHY3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor Rv3680
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003896|Rv3677c|
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR