Rv2478c Family assigned · medium auto-curated

H37Rv Rv2478c · MTBC0 - · 161 aa · 2784123–2784608 (-) · RefSeq NP_216994.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains SSB (PF00436.32) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53205 TrEMBL · unreviewed · Predicted
UniProt nameSingle-stranded DNA-binding protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namessb2
eggNOG descriptionSingle-stranded DNA-binding protein
Orthologous groupCOG0629
KEGG orthology K03111
KEGG pathways map03030, map03430, map03440

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SSBPF00436.32 7.2e-151–96 Single-strand binding protein family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ettA (macrolide ABC transporter ATP-binding protein), high confidence from genomic context alone (score 796 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0054 ssb single-strand DNA-binding protein 913 910 database:900
Rv3370c dnaE2 error-prone DNA polymerase 824 809 experimental:773
Rv3644c DNA polymerase 823 806 experimental:773
Rv2228c multifunctional RNASE H/alpha-ribazole phosphatase/acid phosphatase 816 797 experimental:775
Rv2477c ettA macrolide ABC transporter ATP-binding protein 796 796 ctx neighborhood:786
Rv1402 priA primosomal protein N' 812 792 experimental:787
Rv1547 dnaE1 DNA polymerase III subunit alpha 799 781 experimental:773
Rv3721c dnaZX DNA polymerase III subunit gamma/tau 809 780 experimental:773
Rv0053 rpsF 30S ribosomal protein S6 765 736 coexpression:721
Rv0651 rplJ 50S ribosomal protein L10 717 717 coexpression:680
Rv2476c gdh NAD-dependent glutamate dehydrogenase 713 713 ctx neighborhood:710
Rv0683 rpsG 30S ribosomal protein S7 713 713 coexpression:665
Rv0700 rpsJ 30S ribosomal protein S10 733 703 coexpression:664
Rv0640 rplK 50S ribosomal protein L11 713 703 coexpression:650
Rv2474c hyp hypothetical protein 701 701 ctx neighborhood:699

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): SSB PF00436.32 (E=7e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216994.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SSB (PF00436.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0629
  • Curated reference: UniProt O53205 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 95 functional partner(s); context anchor ettA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2478c|
MVGHIVNDLQRRKVGDQEVVKFRVASNSRRRTSDGGWEPGNSLFITVNCWGRLVTGVGAALGKGAPVIVVGHVYTSEYEDRDGIRRSSLEMRATSVGPDLSRVIVRIEKPAYTGPSAGDLPAATGTGAAGAADAPASAADSVSDVVVDDAITGHNPLPISA