Rv3360 Family assigned · medium auto-curated

H37Rv Rv3360 · MTBC0 mtbc0_003575 · 122 aa · 3799359–3799727 (+) · RefSeq NP_217877.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationFHA domain-containing protein
Revised (this work)FHA domain-containing protein. Pfam: FHA (PF00498.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O50389 TrEMBL · unreviewed · Predicted
UniProt nameFHA domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionInner membrane component of T3SS, cytoplasmic domain
Orthologous groupCOG1716

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.343 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 6.00% of strains (8707) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FHAPF00498.32 6.5e-1326–89 FHA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3359 (oxidoreductase), medium confidence from genomic context alone (score 509 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 985 984 experimental:984
Rv0014c pknB serine/threonine-protein kinase PknB 937 732 experimental:711 textmining:775
Rv1364c sigma factor regulatory protein 687 686 coexpression:646
Rv1277 hyp hypothetical protein 641 628 database:579
Rv1278 hyp hypothetical protein 641 628 database:579
Rv3451 cut3 cutinase 595 596 database:530
Rv3724A cut5a Rv3724A, (MTV025.072), len: 80 aa. Probable cut5a,truncated cutinase precursor, similar to N-terminal end of others e.g. Q9KK87 serine ester 595 596 database:530
Rv3483c hyp hypothetical protein 595 595 database:530
Rv3724B cut5b Rv3724B, (MTV025.072), len: 187 aa. Probable cut5b,truncated cutinase, similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 protein ( 593 594 database:530
Rv2301 cut2 cutinase 593 594 database:530
Rv1758 cut1 cutinase 593 594 database:530
Rv0434 hyp hypothetical protein 587 562 database:560
Rv1334 mec [CysO 546 532 database:518
Rv3359 oxidoreductase 509 509 ctx neighborhood:506
Rv3682 ponA2 bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase 489 457 experimental:420

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: FHA domain-containing protein
  • Pfam (hmmscan --cut_ga): FHA PF00498.32 (E=6e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217877.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FHA (PF00498.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1716
  • Curated reference: UniProt O50389 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor Rv3359
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003575|Rv3360|
MSRPHPPVLTVRSDRSQQCFAAGRDVVVGSDLRADMRVAHPLIARAHLLLRFDRGNWIAIDNDSQSGMFVDGQRVSEVDIYDGLTINIGKPTGPWITFEVGHHQGIIGRLSRTPSSRPGSPI