Rv3353c Resolved · medium auto-curated
H37Rv Rv3353c · MTBC0 mtbc0_003568 ·
86 aa · 3795444–3795704 (-) ·
RefSeq NP_217870.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | oxidoreductase |
| Revised (this work) | Oxidoreductase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O50382
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | FAD linked oxidase domain protein |
| Orthologous group | COG0277 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3352c (oxidoreductase), medium confidence from genomic context alone (score 528 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1551 plsB1 |
acyltransferase PlsB | 619 | 603 | database:549 |
Rv2482c plsB2 |
glycerol-3-phosphate acyltransferase | 617 | 601 | database:549 |
Rv3354 hyp |
hypothetical protein | 592 | 592 ctx | neighborhood:589 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 590 | 570 | database:552 |
Rv1310 atpD |
ATP synthase subunit beta | 571 | 555 | database:538 |
Rv1305 atpE |
ATP synthase subunit C | 537 | 537 | database:526 |
Rv1501 hyp |
hypothetical protein | 545 | 529 | database:463 |
Rv3352c |
oxidoreductase | 528 | 528 ctx | neighborhood:515 |
Rv3633 hyp |
hypothetical protein | 543 | 526 | database:463 |
Rv1872c lldD2 |
L-lactate dehydrogenase | 537 | 517 | |
Rv0694 mftD |
mycofactocin system heme/flavin oxidoreductase MftD | 535 | 514 | |
Rv3029c fixA |
electron transfer flavoprotein subunit beta | 524 | 501 | |
Rv3028c fixB |
electron transfer flavoprotein subunit alpha | 519 | 496 | |
Rv3417c groEL1 |
chaperonin GroEL | 468 | 449 | |
Rv0440 groEL2 |
molecular chaperone GroEL | 468 | 449 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: oxidoreductase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217870.2)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0277 - Curated reference: UniProt O50382 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
Rv3352c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003568|Rv3353c| MSRQTFLRGAVGAPATSAVFPTILARATPGDGWASLASSIGGQVLLPANGRAFTSGKQIFNSNYSGLNPAAVVTVASQADVRKAVS