Rv3362c Family assigned · medium auto-curated

H37Rv Rv3362c · MTBC0 mtbc0_003577 · 193 aa · 3800282–3800863 MTBC0 (-) · RefSeq NP_217879.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP/GTP-binding protein
MTBC0 PGAP re-annotationATP/GTP-binding protein
Revised (this work)ATP/GTP-binding protein. Pfam: ATP_bind_1 (PF03029.24).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 3 % of gene

NeighbourRv3363c (Rv3363c, - strand)
Overlap20 bp, 3 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.10 (95% CI -0.65 to 3.75). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3397c · 99.5% identity
M. marinum MMAR_1168 · 87.8% identity
M. smegmatis MSMEG_1640 · 77.2% identity
M. orygis RJtmp_003465 · 99.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O50391 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable ATP/GTP-binding protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionConserved hypothetical ATP binding protein
Orthologous groupCOG2229
KEGG orthology K06945

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.68 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 84.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 3/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 68.6%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 0.857, mean read count 55.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.130.044 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 9 of 16 independent MS datasets
Integrated abundance26.1 ppm · rank 2154/3519 (38.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length193 aa
Molecular weight20.7 kDa
Theoretical pI5.35
GRAVY0.209 (hydrophobic)
Aliphatic index94.1
Aromaticity0.083
Instability index45.3 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ATP_bind_1PF03029.24 6.1e-3318–186 Conserved hypothetical ATP binding protein

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.7

PDB hitprobTM-scoreE-valueDescription
3t1q-assembly1_A 1.00 0.69 1.6e-09 sig 3t1q-assembly1_A MglA bound to GppNHp in complex with MglB
6izw-assembly1_A 1.00 0.67 3.0e-09 sig 6izw-assembly1_A Myxococcus xanthus MglA bound to GTP-gamma-S and MglB
5ymx-assembly2_B 1.00 0.68 7.3e-09 sig 5ymx-assembly2_B Myxococcus xanthus MglA in GDP bound conformation
8oum-assembly3_C 1.00 0.69 8.3e-09 sig 8oum-assembly3_C Arf GTPase from the asgard Gerdarchaea : GerdArfR1 bound to GTP
8oum-assembly4_D 1.00 0.69 1.0e-08 sig 8oum-assembly4_D Arf GTPase from the asgard Gerdarchaea : GerdArfR1 bound to GTP

Foldseek search of the AlphaFold DB model (mean pLDDT 82.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 5

Upstream (5' on genome)Rv3361c (- strand, 6 bp gap)
Downstream (3' on genome)Rv3363c (- strand, -20 bp gap)
Predicted operon Rv3361c · Rv3362c · Rv3363c · Rv3364c · Rv3365c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3364c hyp exp hypothetical protein 999 1000 ctx neighborhood:882 cooccurence:774 coexpression:807 experimental:917 textmining:838
Rv3363c hyp hypothetical protein 999 995 ctx neighborhood:882 cooccurence:774 coexpression:824 textmining:892
Rv3365c hyp hypothetical protein 992 978 ctx neighborhood:882 cooccurence:758 textmining:656
Rv2921c ftsY exp signal recognition particle receptor FtsY 980 974 experimental:928 database:647
Rv3361c mfpA hyp hypothetical protein 987 933 ctx neighborhood:882 coexpression:458 textmining:822
Rv1004c exp membrane protein 825 804 experimental:787
Rv2916c ffh exp signal recognition particle protein 824 803 experimental:787
Rv0720 rplR exp 50S ribosomal protein L18 790 790 experimental:787
Rv0701 rplC exp 50S ribosomal protein L3 779 779 experimental:771
Rv0709 rpmC exp 50S ribosomal protein L29 779 779 experimental:776
Rv0714 rplN exp 50S ribosomal protein L14 777 777 experimental:776
Rv3443c rplM exp 50S ribosomal protein L13 776 776 experimental:771
Rv0704 rplB exp 50S ribosomal protein L2 773 773 experimental:771
Rv0703 rplW exp 50S ribosomal protein L23 761 761 experimental:759
Rv0722 rpmD exp 50S ribosomal protein L30 642 624 experimental:590

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP/GTP-binding protein
  • MTBC0 PGAP product: ATP/GTP-binding protein
  • Pfam (hmmscan --cut_ga): ATP_bind_1 PF03029.24 (E=6e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217879.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ATP_bind_1 (PF03029.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2229
  • Curated reference: UniProt O50391 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003577|Rv3362c|
MALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPDKRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFAAVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAVSEYALATLSPAGG