Rv3362c Family assigned · medium auto-curated
H37Rv Rv3362c · MTBC0 mtbc0_003577 ·
193 aa ·
3800282–3800863 MTBC0
(-) ·
RefSeq NP_217879.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ATP/GTP-binding protein |
|---|---|
| MTBC0 PGAP re-annotation | ATP/GTP-binding protein |
| Revised (this work) | ATP/GTP-binding protein. Pfam: ATP_bind_1 (PF03029.24). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 3 % of gene
| Neighbour | Rv3363c (Rv3363c, - strand) |
|---|---|
| Overlap | 20 bp, 3 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.10 (95% CI -0.65 to 3.75). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3397c
· 99.5% identity |
|---|---|
| M. marinum |
MMAR_1168
· 87.8% identity |
| M. smegmatis |
MSMEG_1640
· 77.2% identity |
| M. orygis |
RJtmp_003465
· 99.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O50391
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable ATP/GTP-binding protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Conserved hypothetical ATP binding protein |
| Orthologous group | COG2229 |
| KEGG orthology |
K06945
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.68 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 84.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 3/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 68.6% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 0.857, mean read count 55.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -1.13 | 0.044 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 26.1 ppm · rank 2154/3519 (38.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 193 aa |
|---|---|
| Molecular weight | 20.7 kDa |
| Theoretical pI | 5.35 |
| GRAVY | 0.209 (hydrophobic) |
| Aliphatic index | 94.1 |
| Aromaticity | 0.083 |
| Instability index | 45.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ATP_bind_1 | PF03029.24 | 6.1e-33 | 18–186 | Conserved hypothetical ATP binding protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3t1q-assembly1_A |
1.00 | 0.69 | 1.6e-09 sig | 3t1q-assembly1_A MglA bound to GppNHp in complex with MglB |
6izw-assembly1_A |
1.00 | 0.67 | 3.0e-09 sig | 6izw-assembly1_A Myxococcus xanthus MglA bound to GTP-gamma-S and MglB |
5ymx-assembly2_B |
1.00 | 0.68 | 7.3e-09 sig | 5ymx-assembly2_B Myxococcus xanthus MglA in GDP bound conformation |
8oum-assembly3_C |
1.00 | 0.69 | 8.3e-09 sig | 8oum-assembly3_C Arf GTPase from the asgard Gerdarchaea : GerdArfR1 bound to GTP |
8oum-assembly4_D |
1.00 | 0.69 | 1.0e-08 sig | 8oum-assembly4_D Arf GTPase from the asgard Gerdarchaea : GerdArfR1 bound to GTP |
Foldseek search of the AlphaFold DB model (mean pLDDT 82.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | Rv3361c (- strand, 6 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3363c (- strand, -20 bp gap) |
| Predicted operon |
Rv3361c · Rv3362c · Rv3363c · Rv3364c · Rv3365c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3364c hyp exp |
hypothetical protein | 999 | 1000 ctx | neighborhood:882 cooccurence:774 coexpression:807 experimental:917 textmining:838 |
Rv3363c hyp |
hypothetical protein | 999 | 995 ctx | neighborhood:882 cooccurence:774 coexpression:824 textmining:892 |
Rv3365c hyp |
hypothetical protein | 992 | 978 ctx | neighborhood:882 cooccurence:758 textmining:656 |
Rv2921c ftsY exp |
signal recognition particle receptor FtsY | 980 | 974 | experimental:928 database:647 |
Rv3361c mfpA hyp |
hypothetical protein | 987 | 933 ctx | neighborhood:882 coexpression:458 textmining:822 |
Rv1004c exp |
membrane protein | 825 | 804 | experimental:787 |
Rv2916c ffh exp |
signal recognition particle protein | 824 | 803 | experimental:787 |
Rv0720 rplR exp |
50S ribosomal protein L18 | 790 | 790 | experimental:787 |
Rv0701 rplC exp |
50S ribosomal protein L3 | 779 | 779 | experimental:771 |
Rv0709 rpmC exp |
50S ribosomal protein L29 | 779 | 779 | experimental:776 |
Rv0714 rplN exp |
50S ribosomal protein L14 | 777 | 777 | experimental:776 |
Rv3443c rplM exp |
50S ribosomal protein L13 | 776 | 776 | experimental:771 |
Rv0704 rplB exp |
50S ribosomal protein L2 | 773 | 773 | experimental:771 |
Rv0703 rplW exp |
50S ribosomal protein L23 | 761 | 761 | experimental:759 |
Rv0722 rpmD exp |
50S ribosomal protein L30 | 642 | 624 | experimental:590 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ATP/GTP-binding protein
- MTBC0 PGAP product: ATP/GTP-binding protein
- Pfam (hmmscan --cut_ga): ATP_bind_1 PF03029.24 (E=6e-33)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217879.1)
- Domains: Pfam-A via hmmscan --cut_ga — ATP_bind_1 (PF03029.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2229 - Curated reference: UniProt O50391 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003577|Rv3362c| MALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPDKRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFAAVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAVSEYALATLSPAGG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3362c? Email the maintainer — the message is pre-filled with this gene's details.