MTBC Gene Atlas

Rv3363c Still unknown · low

H37Rv Rv3363c · MTBC0 mtbc0_003578 · 122 aa · 3800844–3801212 (-) · RefSeq NP_217880.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF742 domain-containing protein
Revised (this work)Conserved hypothetical; function unknown. Structure-based hint rejected: non-transferable cross-kingdom fold (human FAM91A1/TBC1D23 Golgi trafficking); function unknown.

Curated reference (UniProt)

UniProt O50392 TrEMBL · unreviewed · Predicted
UniProt nameDUF742 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionProtein of unknown function (DUF742)
Orthologous groupCOG1846

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF742PF05331.18 2.6e-3610–122 Protein of unknown function (DUF742)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 58.2 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8jj9-assembly1_A 0.99 0.68 4.5e-02 8jj9-assembly1_A Human FAM91A1 N terminal domain in complex with TBC1D23
8fw5-assembly1_B 0.99 0.69 5.9e-02 8fw5-assembly1_B Chimeric HsGATOR1-SpGtr-SpLam complex
2yu3-assembly1_A 0.98 0.58 2.3e-02 2yu3-assembly1_A Solution structure of the domain swapped WingedHelix in DNA-directed RNA polymerase III 39 kDa polypeptide
8fw5-assembly1_C 0.85 0.68 4.0e-01 8fw5-assembly1_C Chimeric HsGATOR1-SpGtr-SpLam complex
3k9t-assembly1_A 0.47 0.56 5.8e-01 3k9t-assembly1_A Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution
7t3c-assembly1_B 0.44 0.59 7.1e-01 7t3c-assembly1_B GATOR1-RAG-RAGULATOR - Dual Complex
3tgn-assembly1_B 0.30 0.67 2.1e+00 3tgn-assembly1_B Crystal Structure of the zinc-dependent MarR Family Transcriptional Regulator AdcR in the Zn(II)-bound State
6cet-assembly1_N 0.18 0.58 2.7e+00 6cet-assembly1_N Cryo-EM structure of GATOR1

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3362c (ATP/GTP-binding protein), high confidence from genomic context alone (score 995 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3362c ATP/GTP-binding protein 999 995 ctx neighborhood:882 cooccurence:774 coexpression:824 textmining:892
Rv3364c hyp hypothetical protein 997 984 ctx neighborhood:882 cooccurence:774 coexpression:458 textmining:870
Rv3365c hyp hypothetical protein 997 981 ctx neighborhood:882 cooccurence:772 textmining:881
Rv3361c mfpA hyp hypothetical protein 995 967 ctx neighborhood:882 coexpression:735 textmining:870
Rv0860 fadB fatty oxidation protein FadB 797 788 coexpression:647
Rv3028c fixB electron transfer flavoprotein subunit alpha 668 654 coexpression:412 experimental:419
Rv3029c fixA electron transfer flavoprotein subunit beta 664 650 coexpression:406 experimental:418
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 652 638
Rv2940c mas multifunctional mycocerosic acid synthase 619 588 database:459
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 619 588 database:459
Rv2048c pks12 polyketide synthase 619 588 database:459
Rv1043c hyp hypothetical protein 586 587 database:431
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 617 586 database:459
Rv1527c pks5 polyketide synthase 615 584 database:459
Rv0673 echA4 enoyl-CoA hydratase EchA4 577 578

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Structural Foldseek hit not propagated -- non-transferable cross-kingdom fold (human FAM91A1/TBC1D23 Golgi trafficking); function unknown
  • Reviewed against literature (extended structural cross-check, 2026-06-02)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217880.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF742 (PF05331.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1846
  • Curated reference: UniProt O50392 (TrEMBL, unreviewed; Predicted)
  • Model confidence: ESMFold per-residue pLDDT (mean 58.2, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 112 functional partner(s); context anchor Rv3362c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003578|Rv3363c|
MFNPAGDRPKAGLVRPYTLTAGRTGTDVDLPLQAPVQTLPAGPAGRWPAYDMRRRILQLCIGSPSVAEISARLDLPVGVARVLVGDLVTSGYLRVHATLTDRSTRDERHELIGRTLRGLKAL