relJ Resolved · high auto-curated

H37Rv Rv3357 · MTBC0 mtbc0_003572 · 91 aa · 3797481–3797756 MTBC0 (+) · RefSeq NP_217874.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin RelJ
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin RelJ
Revised (this work)Type II toxin-antitoxin system antitoxin RelJ. Pfam: PhdYeFM_antitox (PF02604.27).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 6 publications

6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

Most recent 5 of 6.
PublicationDate
RelK, a YoeB-like toxin from Mycobacterium tuberculosis displays ribosome independent endonucleolytic activity. doi:10.1016/j.bbamcr.2025.120097 2026
Ser/Thr phosphorylation of Mycobacterium tuberculosis type II RelK toxin by PknK destabilizes TA interaction and interferes with toxin neutralization. doi:10.1128/mbio.01068-25 2025
Investigation of potential relationship betweenmazEF3, relJK, and vapBC3 genes and antimicrobial resistance inMycobacterium bovis. doi:10.1186/s12879-025-11168-y 2025
The Mycobacterium tuberculosis relBE toxin:antitoxin genes are stress-responsive modules that regulate growth through translation inhibition. doi:10.1007/s12275-015-5333-8 2015
Characterization of the interaction between a SirR family transcriptional factor of Mycobacterium tuberculosis, encoded by Rv2788, and a pair of toxin-antitoxin proteins RelJ/K, encoded by Rv3357 and Rv3358. doi:10.1111/febs.12815 2014

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourrelK (Rv3358, + strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.55 (95% CI -0.36 to 1.67). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3392 · 100.0% identity
M. orygis RJtmp_003460 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WF25 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin RelJ
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. A probable antitoxin for the putative mRNA interferase RelK. Upon expression in E.coli but not in M.smegmatis this protein neutralizes E.coli YoeB.; FUNCTION: Binds to and represses its own promoter, in combination with RelK repression is somewhat lessened. Several DNA-protein complexes are formed in vitro depending on the RelJ:RelK ratio.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerelJ
eggNOG descriptionAntitoxin component of a toxin-antitoxin (TA) module
Orthologous groupCOG2161
KEGG orthology K19159
Gene Ontology (19) GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0019219, GO:0019222, GO:0031323, GO:0031326, GO:0050789, GO:0050794, GO:0051171 +7 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.312 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 11/53 (21%) · mean identity 58.5% · 4/4 closest MTBAP relatives
present in a subset of the genus (11/53 NTM; in 4 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 47.8%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 165.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance51.5 ppm · rank 1732/3519 (50.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length91 aa
Molecular weight10.2 kDa
Theoretical pI4.97
GRAVY-0.557 (hydrophilic)
Aliphatic index75.2
Aromaticity0.055
Instability index65.4 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PhdYeFM_antitoxPF02604.27 4.8e-222–72 Antitoxin Phd_YefM, type II toxin-antitoxin system

Experimental structures (Protein Data Bank) 3 solved

PDBMethodResolutionCoverage
3d55 X-ray diffraction 2.13 Å 100%
3oei X-ray diffraction 2.145 Å 100%
3cto X-ray diffraction 2.5 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.6

PDB hitprobTM-scoreE-valueDescription
3oei-assembly3_J 1.00 0.83 5.3e-13 sig 3oei-assembly3_J Crystal structure of Mycobacterium tuberculosis RelJK (Rv3357-Rv3358-RelBE3)
3oei-assembly4_N 1.00 0.86 1.5e-12 sig 3oei-assembly4_N Crystal structure of Mycobacterium tuberculosis RelJK (Rv3357-Rv3358-RelBE3)
3oei-assembly4_M 1.00 0.78 9.8e-13 sig 3oei-assembly4_M Crystal structure of Mycobacterium tuberculosis RelJK (Rv3357-Rv3358-RelBE3)
3oei-assembly2_E 1.00 0.75 1.6e-12 sig 3oei-assembly2_E Crystal structure of Mycobacterium tuberculosis RelJK (Rv3357-Rv3358-RelBE3)
3cto-assembly1_A 1.00 0.83 9.5e-11 sig 3cto-assembly1_A Crystal Structure of M. tuberculosis YefM antitoxin

Foldseek search of the AlphaFold DB model (mean pLDDT 93.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)folD (- strand, 123 bp gap)
Downstream (3' on genome)relK (+ strand, -4 bp gap)
Predicted operon relJ · relK · Rv3359

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) trcR (activates) · Rv1719 (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: relK (toxin RelK), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3358 relK exp toxin RelK 999 999 ctx neighborhood:882 cooccurence:773 experimental:966 textmining:929
Rv3359 oxidoreductase 665 664 ctx neighborhood:661
Rv3356c folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 588 589 ctx neighborhood:589
Rv3355c integral membrane protein 556 557 ctx neighborhood:557
Rv2788 sirR exp transcriptional repressor SirR 499 500 experimental:500
Rv3360 hyp hypothetical protein 429 429 ctx neighborhood:426
Rv2866 relG toxin RelG 764 295 textmining:680
Rv1246c relE toxin RelE 897 194 textmining:878
Rv2461c clpP1 ATP-dependent CLP protease proteolytic subunit 1 483 77 textmining:464
Rv3749c vapC50 hyp hypothetical protein 655 73 textmining:644
Rv1495 mazF4 mRNA interferase MazF4 577 68 textmining:565
Rv2720 lexA repressor LexA 451 62 textmining:439
Rv1991c mazF6 mRNA interferase MazF6 467 61 textmining:456
Rv2801c mazF9 mRNA interferase MazF9 540 58 textmining:532
Rv2063A mazF7 mRNA interferase MazF7 645 55 textmining:640

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin RelJ
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin RelJ
  • Pfam (hmmscan --cut_ga): PhdYeFM_antitox PF02604.27 (E=5e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217874.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PhdYeFM_antitox (PF02604.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2161
  • Curated reference: UniProt P9WF25 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor relK
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003572|Rv3357|relJ
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE