relJ Resolved · high auto-curated

H37Rv Rv3357 · MTBC0 mtbc0_003572 · 91 aa · 3797481–3797756 (+) · RefSeq NP_217874.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin RelJ
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin RelJ
Revised (this work)Type II toxin-antitoxin system antitoxin RelJ. Pfam: PhdYeFM_antitox (PF02604.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF25 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin RelJ
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. A probable antitoxin for the putative mRNA interferase RelK. Upon expression in E.coli but not in M.smegmatis this protein neutralizes E.coli YoeB.; FUNCTION: Binds to and represses its own promoter, in combination with RelK repression is somewhat lessened. Several DNA-protein complexes are formed in vitro depending on the RelJ:RelK ratio.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerelJ
eggNOG descriptionAntitoxin component of a toxin-antitoxin (TA) module
Orthologous groupCOG2161
KEGG orthology K19159
Gene Ontology (19) GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0019219, GO:0019222, GO:0031323, GO:0031326, GO:0050789, GO:0050794, GO:0051171 +7 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.312 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PhdYeFM_antitoxPF02604.27 4.8e-222–72 Antitoxin Phd_YefM, type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: relK (toxin RelK), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3358 relK toxin RelK 999 999 ctx neighborhood:882 cooccurence:773 experimental:966 textmining:929
Rv3359 oxidoreductase 665 664 ctx neighborhood:661
Rv3356c folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 588 589 ctx neighborhood:589
Rv3355c integral membrane protein 556 557 ctx neighborhood:557
Rv2788 sirR transcriptional repressor SirR 499 500 experimental:500
Rv3360 hyp hypothetical protein 429 429 ctx neighborhood:426
Rv2866 relG toxin RelG 764 295 textmining:680
Rv1246c relE toxin RelE 897 194 textmining:878
Rv2461c clpP1 ATP-dependent CLP protease proteolytic subunit 1 483 77 textmining:464
Rv3749c vapC50 hyp hypothetical protein 655 73 textmining:644
Rv1495 mazF4 mRNA interferase MazF4 577 68 textmining:565
Rv2720 lexA repressor LexA 451 62 textmining:439
Rv1991c mazF6 mRNA interferase MazF6 467 61 textmining:456
Rv2801c mazF9 mRNA interferase MazF9 540 58 textmining:532
Rv2063A mazF7 mRNA interferase MazF7 645 55 textmining:640

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin RelJ
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin RelJ
  • Pfam (hmmscan --cut_ga): PhdYeFM_antitox PF02604.27 (E=5e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217874.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PhdYeFM_antitox (PF02604.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2161
  • Curated reference: UniProt P9WF25 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor relK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003572|Rv3357|relJ
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE