mfpA Resolved · high auto-curated

H37Rv Rv3361c · MTBC0 mtbc0_003576 · 183 aa · 3799724–3800275 (-) · RefSeq NP_217878.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationpentapeptide repeat protein MfpA
Revised (this work)Pentapeptide repeat protein MfpA. Pfam: Pentapeptide_3 (PF13576.13), Pentapeptide (PF00805.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YBX3 SwissProt · reviewed · Evidence at protein level
UniProt namePentapeptide repeat protein MfpA
Curated functionMight be involved in fluoroquinolone resistance. Inhibits ATP-independent DNA relaxation, ATP-dependent DNA supercoiling and ATP-dependent decatenation by endogenous gyrase, 50% inhibition occurs at 2 uM; inhibition is abolished if GyrA is mutated (Asp-87 to Gly or His). Also inhibits fluoroquinolone-promoted dsDNA cleavage. Increases fluoroquinolone (ciprofloxacin or moxifloxacin) inhibition of gyrase supercoiling activity in a concentration-dependent manner. Inhibits DNA relaxation and supercoiling by E.coli gyrase. Forms a structure that exhibits size, shape and electrostatic similarity to .

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemfpA
eggNOG descriptionPentapeptide repeat
Orthologous groupCOG1357

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.169 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pentapeptide_3PF13576.13 3.5e-0729–69 Pentapeptide repeats (9 copies)
PentapeptidePF00805.29 2.7e-0788–126 Pentapeptide repeats (8 copies)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3362c (ATP/GTP-binding protein), high confidence from genomic context alone (score 933 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0005 gyrB DNA gyrase subunit B 997 997 experimental:997
Rv3363c hyp hypothetical protein 995 967 ctx neighborhood:882 coexpression:735 textmining:870
Rv3362c ATP/GTP-binding protein 987 933 ctx neighborhood:882 coexpression:458 textmining:822
Rv3365c hyp hypothetical protein 963 888 ctx neighborhood:882 textmining:691
Rv3364c hyp hypothetical protein 984 887 ctx neighborhood:882 textmining:870
Rv3366 spoU tRNA/rRNA methylase SpoU 547 548 ctx neighborhood:541
Rv2719c chiZ membrane protein 564 537
Rv1288 hyp hypothetical protein 522 493
Rv0210 hyp hypothetical protein 436 437 ctx cooccurence:418
Rv0899 arfA peptidoglycan-binding protein ArfA 440 413
Rv1754c hyp hypothetical protein 440 413
Rv3668c protease 438 403
Rv1988 erm(37) 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) 480 119 textmining:434
Rv3671c marP serine protease 522 66 textmining:510
Rv2201 asnB asparagine synthetase 633 56 textmining:628

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: pentapeptide repeat protein MfpA
  • Pfam (hmmscan --cut_ga): Pentapeptide_3 PF13576.13 (E=3e-07), Pentapeptide PF00805.29 (E=3e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217878.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pentapeptide_3 (PF13576.13), Pentapeptide (PF00805.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1357
  • Curated reference: UniProt I6YBX3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor Rv3362c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003576|Rv3361c|mfpA
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG