spoU Resolved · high auto-curated
H37Rv Rv3366 · MTBC0 mtbc0_003581 ·
154 aa ·
3804445–3804909 MTBC0
(+) ·
RefSeq NP_217883.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | tRNA/rRNA methylase SpoU |
|---|---|
| MTBC0 PGAP re-annotation | tRNA (cytidine(34)-2'-O)-methyltransferase |
| Revised (this work) | TRNA (cytidine(34)-2'-O)-methyltransferase. Pfam: SpoU_methylase (PF00588.25). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Structural, functional and biophysical characterization of two cryptic RNA methyltransferases (Rv3366 and Rv3919c) of Mycobacterium tuberculosis. doi:10.1080/07391102.2026.2687102 | 2026 |
| Saskemycin, a potent and selective antimycobacterial agent targeting a unique site on the ribosome. doi:10.21203/rs.3.rs-7820265/v1 | 2025 |
| Computational analysis of RNA methyltransferase Rv3366 as a potential drug target for combating drug-resistant Mycobacterium tuberculosis. doi:10.3389/fmolb.2023.1348337 | 2023 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
PyrR (pyrR), Unc_7.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.05 (95% CI -1.94 to 2.46). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Causes methylation |
|---|---|
| Mycobrowser EC |
2.1.1.-
· superseded EC numbering; the atlas uses the current class (2.1.1.207)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3401
· 100.0% identity |
|---|---|
| M. leprae |
ML0419c
· 83.8% identity |
| M. marinum |
MMAR_1163
· 83.8% identity |
| M. smegmatis |
MSMEG_1636
· 82.5% identity |
| M. orygis |
RJtmp_003469
· 100.0% identity |
| M. abscessus |
MAB_3702
· 71.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O50394
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative tRNA |
| EC (curated) |
EC 2.1.1.207
|
| Curated function | Could methylate the ribose at the nucleotide 34 wobble position in tRNA. |
UniProt still lists this protein as Putative tRNA; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | spoU |
| eggNOG description | Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family. TrmL subfamily |
| Orthologous group | COG0219 |
| EC number |
EC 2.1.1.207
|
| KEGG orthology |
K03216
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (156) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 84.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 61.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 0.857, mean read count 151.333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 24.0 ppm · rank 2215/3519 (37.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 154 aa |
|---|---|
| Molecular weight | 16.5 kDa |
| Theoretical pI | 6.58 |
| GRAVY | 0.177 (hydrophobic) |
| Aliphatic index | 92.7 |
| Aromaticity | 0.084 |
| Instability index | 28.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SpoU_methylase | PF00588.25 | 2.2e-29 | 2–142 | SpoU rRNA Methylase family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4kdz-assembly1_A |
1.00 | 0.95 | 8.4e-21 sig | 4kdz-assembly1_A Crystal structure of tRNA/rRNA methyltransferase YibK from Escherichia coli (Target NYSGRC-012599) |
4kgn-assembly1_B |
1.00 | 0.93 | 3.8e-20 sig | 4kgn-assembly1_B Crystal structure of a tRNA (cytidine(34)-2'-O)-methyltransferase bound to S-adenosyl homocysteine |
1j85-assembly1_A |
1.00 | 0.95 | 3.0e-19 sig | 1j85-assembly1_A Structure of YibK from Haemophilus influenzae (HI0766), a truncated sequence homolog of tRNA (guanosine-2'-O-) methyltransferase (SpoU) |
7e3q-assembly1_B |
1.00 | 0.93 | 3.2e-19 sig | 7e3q-assembly1_B Crystal structure of SAH bound TrmL from Vibrio vulnificus |
7d51-assembly1_B |
1.00 | 0.92 | 3.2e-19 sig | 7d51-assembly1_B Crystal structure of a truly knotted protein: cyclized YibK from Haemophilus influenzae |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3365c (- strand, 235 bp gap) |
|---|---|
| Downstream (3' on genome) | PE_PGRS51 (+ strand, 366 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv3362c (ATP/GTP-binding protein), medium confidence from genomic context alone (score 495 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3361c mfpA hyp |
hypothetical protein | 547 | 548 ctx | neighborhood:541 |
Rv3365c hyp |
hypothetical protein | 529 | 529 ctx | neighborhood:526 |
Rv2462c tig |
trigger factor | 525 | 525 | |
Rv3363c hyp |
hypothetical protein | 523 | 523 ctx | neighborhood:518 |
Rv3362c |
ATP/GTP-binding protein | 494 | 495 ctx | neighborhood:491 |
Rv3364c hyp |
hypothetical protein | 493 | 492 ctx | neighborhood:486 |
Rv2882c frr |
ribosome recycling factor | 424 | 425 | coexpression:422 |
Rv3367 PE_PGRS51 |
PE-PGRS family protein PE_PGRS51 | 410 | 410 ctx | neighborhood:410 |
Rv1407 fmu |
16S rRNA m5C967 methyltransferase | 462 | 290 | |
Rv0208c trmB |
tRNA (guanine-N(7)-)-methyltransferase | 448 | 280 | |
Rv0557 mgtA |
GDP-mannose-dependent alpha-mannosyltransferase | 452 | 217 | |
Rv2966c rsmD |
methyltransferase | 830 | 153 | textmining:808 |
Rv3442c rpsI |
30S ribosomal protein S9 | 835 | 74 | textmining:830 |
Rv2765 |
hydrolase | 662 | 73 | textmining:651 |
Rv1781c malQ |
4-alpha-glucanotransferase | 628 | 51 | textmining:625 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: tRNA/rRNA methylase SpoU
- MTBC0 PGAP product: tRNA (cytidine(34)-2'-O)-methyltransferase
- Pfam (hmmscan --cut_ga): SpoU_methylase PF00588.25 (E=2e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217883.1)
- Domains: Pfam-A via hmmscan --cut_ga — SpoU_methylase (PF00588.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0219 - Curated reference: UniProt O50394 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
Rv3362c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003581|Rv3366|spoU MFRLLFVSPRIAPNTGNAIRTCAATGCELHLVEPLGFDLSEPKLRRAGLDYHDLASVTVHASLAHAWEALSPARVFAFTAQATTLFTNVGYRAGDVLMFGPEPTGLDEATLADTHITGQVRIPMLAGRRSLNLSNAAAVAVYEAWRQHGFAGAV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for spoU? Email the maintainer — the message is pre-filled with this gene's details.