Rv1277 Family assigned · medium auto-curated

H37Rv Rv1277 · MTBC0 - · 417 aa · 1426164–1427417 (+) · RefSeq NP_215793.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Metallophos (PF00149.34) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q50699 TrEMBL · unreviewed · Evidence at protein level
UniProt nameNuclease SbcCD subunit D

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namesbcD
eggNOG descriptionDNA repair exonuclease
Orthologous groupCOG0420

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.146 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MetallophosPF00149.34 2.1e-0935–201 Calcineurin-like phosphoesterase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1279 (GMC-type oxidoreductase), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1278 hyp hypothetical protein 999 1000 ctx neighborhood:881 cooccurence:774 coexpression:926 experimental:928 database:844
Rv1629 polA DNA polymerase I 989 980 experimental:836 database:844 textmining:494
Rv2090 5'-3' exonuclease 937 930 experimental:777 database:652
Rv1329c dinG ATP-dependent helicase DinG 930 919 experimental:771 database:639
Rv1279 GMC-type oxidoreductase 889 889 ctx neighborhood:853
Rv2737c recA recombinase A 908 853 experimental:449 database:635 textmining:406
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 796 785 experimental:784
Rv3646c topA DNA topoisomerase I 846 784 database:654
Rv1276c hyp hypothetical protein 742 742 ctx neighborhood:740
Rv2529 hyp hypothetical protein 767 730 database:615
Rv1527c pks5 polyketide synthase 736 720 experimental:404 database:511
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 736 720 experimental:404 database:511
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 736 720 experimental:404 database:511
Rv2940c mas multifunctional mycocerosic acid synthase 736 720 experimental:404 database:511
Rv2048c pks12 polyketide synthase 735 719 experimental:404 database:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Metallophos PF00149.34 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215793.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Metallophos (PF00149.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0420
  • Curated reference: UniProt Q50699 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 141 functional partner(s); context anchor Rv1279
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1277|
MSPRPGPAGRGPAPCRCADLHSLCVDSHALRRDGMRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLKALAADVGAEFVVVAGDVFEHNQLAPQIVGQSLEAMRVIGLPVYLLPGNHDPLDASSVYTSTLFRAERPDNVVVLDRAGVHEVRPGVQIVAAPWRSKAPTTDPVAEVLAGLPTDAAIRLLVAHGGVDALDPDHDKPSLIRLAALDDALTRQAIHYVALGDKHSLTQVGSSGRVWYSGAPEVTNFDDVEPDPGHVLVVDIDESDPRHPVTVDARRIGRWRFVTLHHQVDTSRDIADLDLNLDLMTDKDRTVVRLALTGSLTVTDRAALDTCLDKYARLFAWLGLWERHTDLAVIPVDAEFTDLGIGGFAAAAVDELVATARGGDDESAVDAQAALALLLRLADRGAA