Rv3483c Family assigned · medium auto-curated

H37Rv Rv3483c · MTBC0 mtbc0_003698 · 220 aa · 3926732–3927394 (-) · RefSeq NP_218000.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationLppP/LprE family lipoprotein
Revised (this work)LppP/LprE family lipoprotein. Pfam: Lipoprotein_21 (PF14041.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X7F2 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible exported protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionLppP/LprE lipoprotein
Orthologous group2DTE8

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.756 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 24.30% of strains (35292) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lipoprotein_21PF14041.12 4.5e-26118–204 LppP/LprE lipoprotein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3482c (membrane protein), high confidence from genomic context alone (score 839 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3482c membrane protein 839 839 ctx neighborhood:821
Rv1747 ABC transporter ATP-binding protein/permease 662 649 database:530
Rv0153c ptbB phosphotyrosine protein phosphatase 651 637 experimental:629
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 647 629 experimental:629
Rv0434 hyp hypothetical protein 610 611 database:561
Rv0832 PE_PGRS12 PE-PGRS family protein PE_PGRS12 601 598 database:543
Rv3036c TB22.2 hyp hypothetical protein 601 598 database:543
Rv2328 PE23 PE family protein PE23 601 598 database:543
Rv3812 PE_PGRS62 PE-PGRS family protein PE_PGRS62 601 598 database:543
Rv0020c fhaA FHA domain-containing protein FhaA 596 596 database:530
Rv3360 hyp hypothetical protein 595 595 database:530
Rv0019c fhaB FHA domain-containing protein FhaB 595 595 database:530
Rv1827 garA glycogen accumulation regulator GarA 595 595 database:530
Rv3484 cpsA hyp hypothetical protein 787 583 ctx neighborhood:578 textmining:510
Rv1277 hyp hypothetical protein 559 559 database:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: LppP/LprE family lipoprotein
  • Pfam (hmmscan --cut_ga): Lipoprotein_21 PF14041.12 (E=4e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218000.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lipoprotein_21 (PF14041.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DTE8
  • Curated reference: UniProt I6X7F2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor Rv3482c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003698|Rv3483c|
MSDEIDPDWPAPAYQPSDDVDTTPPAPGGSWPTAWLVALVVLACVAAAVVAYAGMHRVRPGANQAAPATTSAPARPTSPASQVGPCGPDEATAVRAALAQLAPDSKTGRPWNSTPEDSNYDPCADLSAVLVTVQDATNSSPDQALMFHRGTFVGTATPRAYPFTNLIGPASTNDIVVLSYRTRQSCDGCQDGILTIVGFAWRGDHVQILDSLPELFDAPP