Rv0843 Family assigned · medium auto-curated

H37Rv Rv0843 · MTBC0 mtbc0_000898 · 334 aa · 942539–943543 (+) · RefSeq NP_215358.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dehydrogenase
MTBC0 PGAP re-annotationthiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
Revised (this work)Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha. Pfam: E1_dh (PF00676.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XWE5 TrEMBL · unreviewed · Predicted
UniProt nameProbable dehydrogenase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionDehydrogenase E1 component
Orthologous groupCOG1071
EC number EC 1.2.4.1
KEGG orthology K00161
KEGG pathways map00010, map00020, map00620, map01100, map01110, map01120, map01130, map01200, map04066, map04922, map05230
KEGG modules M00307

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.96 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
E1_dhPF00676.26 4.3e-4141–312 Dehydrogenase E1 component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bkdB (3-methyl-2-oxobutanoate dehydrogenase subunit beta), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 999 1000 ctx fusion:899 cooccurence:774 coexpression:728 experimental:829 database:662 textmining:415
Rv2495c bkdC branched-chain keto acid dehydrogenase E2 component 983 978 ctx cooccurence:772 coexpression:599 experimental:415 database:591
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 981 974 ctx cooccurence:740 coexpression:597 experimental:415 database:591
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 975 966 coexpression:597 experimental:415 database:844
Rv1734c hyp hypothetical protein 940 921 coexpression:601 experimental:415 database:591
Rv0842 integral membrane protein 887 887 ctx neighborhood:882
Rv0462 lpdC dihydrolipoamide dehydrogenase 900 879 ctx cooccurence:443 coexpression:497 database:580
Rv3303c lpdA NAD(P)H quinone reductase LpdA 877 870 ctx cooccurence:414 coexpression:497 database:580
Rv2855 mtr mycothione reductase 864 852 coexpression:500 database:580
Rv0794c oxidoreductase 857 844 coexpression:502 database:580
Rv2713 sthA pyridine nucleotide transhydrogenase 851 818 coexpression:500 database:580
Rv0018c pstP phosphoserine/threonine phosphatase PstP 706 697 database:565
Rv1017c prsA ribose-phosphate pyrophosphokinase 705 676 database:632
Rv1826 gcvH glycine cleavage system protein H 679 659 database:658
Rv2998A Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sens 526 505 database:429

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dehydrogenase
  • MTBC0 PGAP product: thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
  • Pfam (hmmscan --cut_ga): E1_dh PF00676.26 (E=4e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215358.1)
  • Domains: Pfam-A via hmmscan --cut_ga — E1_dh (PF00676.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1071
  • Curated reference: UniProt I6XWE5 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor bkdB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000898|Rv0843|
MTRTSEGLAAFVVDQLEELYRRMWVLRLLDMALEQLRIEGLINGPLQGGFGQEAVSVGAAAALGEGDVIITTHRPHAQHVGTDAPLGPVIADMLGATAGDLEGADEDAHIADPRAGLPAAIRVVKQSPLLAIGHAYALWLRDTGRVTLCVTQDCDVDADAFNEAADLAAVWQLPVVILVENIRGALSVHLDRYTHEPRVYRRAVAYGMPGVSVDGNDVEAVRDCVANAVVRARAGGGPTLVQAITYRTTDFSGSDRGGYRDLAGSEQFLDPLIFARRRLIAAGTTRGRLDEQERAACQQVADAVAFAKARARPNGGGPISRPTSGWHQQPKTRF