Rv0843 Family assigned · medium auto-curated
H37Rv Rv0843 · MTBC0 mtbc0_000898 ·
334 aa ·
942539–943543 MTBC0
(+) ·
RefSeq NP_215358.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha |
| Revised (this work) | Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha. Pfam: E1_dh (PF00676.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene
| Neighbour | Rv0842 (Rv0842, + strand) |
|---|---|
| Overlap | 17 bp, 2 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.68 (95% CI -2.91 to 5.39). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; probably involved in cellular metabolism. |
|---|---|
| Mycobrowser EC |
1.-.-.-
· superseded EC numbering; the atlas uses the current class (1.2.4.1)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0866
· 99.1% identity |
|---|---|
| M. marinum |
MMAR_4784
· 48.6% identity |
| M. orygis |
RJtmp_000893
· 99.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6XWE5
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable dehydrogenase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | Dehydrogenase E1 component |
| Orthologous group | COG1071 |
| EC number |
EC 1.2.4.1
|
| KEGG orthology |
K00161
|
| KEGG pathways |
map00010, map00020, map00620, map01100, map01110, map01120, map01130, map01200, map04066, map04922, map05230
|
| KEGG modules |
M00307
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.96 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
1.082 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 43.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 34.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 18 in the ORF — 0 in the essential state, 0 growth-defect, 18 non-essential, 0 growth-advantage. Saturation 0.889, mean read count 153.4375. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Physico-chemical properties (computed, ProtParam)
| Length | 334 aa |
|---|---|
| Molecular weight | 35.8 kDa |
| Theoretical pI | 5.65 |
| GRAVY | -0.088 (hydrophilic) |
| Aliphatic index | 93.3 |
| Aromaticity | 0.057 |
| Instability index | 35.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
E1_dh | PF00676.26 | 4.3e-41 | 41–312 | Dehydrogenase E1 component |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2ozl-assembly1_C |
1.00 | 0.89 | 5.8e-21 sig | 2ozl-assembly1_C Human pyruvate dehydrogenase S264E variant |
1umc-assembly1_C |
1.00 | 0.88 | 6.8e-21 sig | 1umc-assembly1_C branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 with 4-methylpentanoate |
3exh-assembly2_G |
1.00 | 0.90 | 2.8e-20 sig | 3exh-assembly2_G Crystal structure of the pyruvate dehydrogenase (E1p) component of human pyruvate dehydrogenase complex |
3exe-assembly2_E |
1.00 | 0.89 | 2.2e-20 sig | 3exe-assembly2_E Crystal structure of the pyruvate dehydrogenase (E1p) component of human pyruvate dehydrogenase complex |
2bff-assembly1_A-2 |
1.00 | 0.92 | 1.3e-19 sig | 2bff-assembly1_A-2 Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch |
Foldseek search of the AlphaFold DB model (mean pLDDT 83.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0842 (+ strand, -17 bp gap) |
|---|---|
| Downstream (3' on genome) | narL (- strand, 63 bp gap) |
| Predicted operon |
Rv0842 · Rv0843
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: bkdB (3-methyl-2-oxobutanoate dehydrogenase subunit beta), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2496c bkdB exp |
3-methyl-2-oxobutanoate dehydrogenase subunit beta | 999 | 1000 ctx | fusion:899 cooccurence:774 coexpression:728 experimental:829 database:662 textmining:415 |
Rv2495c bkdC exp |
branched-chain keto acid dehydrogenase E2 component | 983 | 978 ctx | cooccurence:772 coexpression:599 experimental:415 database:591 |
Rv2215 dlaT exp |
pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase | 981 | 974 ctx | cooccurence:740 coexpression:597 experimental:415 database:591 |
Rv1248c kgd exp |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 975 | 966 | coexpression:597 experimental:415 database:844 |
Rv1734c hyp exp |
hypothetical protein | 940 | 921 | coexpression:601 experimental:415 database:591 |
Rv0842 |
integral membrane protein | 887 | 887 ctx | neighborhood:882 |
Rv0462 lpdC exp |
dihydrolipoamide dehydrogenase | 900 | 879 ctx | cooccurence:443 coexpression:497 database:580 |
Rv3303c lpdA exp |
NAD(P)H quinone reductase LpdA | 877 | 870 ctx | cooccurence:414 coexpression:497 database:580 |
Rv2855 mtr exp |
mycothione reductase | 864 | 852 | coexpression:500 database:580 |
Rv0794c exp |
oxidoreductase | 857 | 844 | coexpression:502 database:580 |
Rv2713 sthA exp |
pyridine nucleotide transhydrogenase | 851 | 818 | coexpression:500 database:580 |
Rv0018c pstP exp |
phosphoserine/threonine phosphatase PstP | 706 | 697 | database:565 |
Rv1017c prsA exp |
ribose-phosphate pyrophosphokinase | 705 | 676 | database:632 |
Rv1826 gcvH exp |
glycine cleavage system protein H | 679 | 659 | database:658 |
Rv2998A exp |
Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sens | 526 | 505 | database:429 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dehydrogenase
- MTBC0 PGAP product: thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
- Pfam (hmmscan --cut_ga): E1_dh PF00676.26 (E=4e-41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215358.1)
- Domains: Pfam-A via hmmscan --cut_ga — E1_dh (PF00676.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1071 - Curated reference: UniProt I6XWE5 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
bkdB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000898|Rv0843| MTRTSEGLAAFVVDQLEELYRRMWVLRLLDMALEQLRIEGLINGPLQGGFGQEAVSVGAAAALGEGDVIITTHRPHAQHVGTDAPLGPVIADMLGATAGDLEGADEDAHIADPRAGLPAAIRVVKQSPLLAIGHAYALWLRDTGRVTLCVTQDCDVDADAFNEAADLAAVWQLPVVILVENIRGALSVHLDRYTHEPRVYRRAVAYGMPGVSVDGNDVEAVRDCVANAVVRARAGGGPTLVQAITYRTTDFSGSDRGGYRDLAGSEQFLDPLIFARRRLIAAGTTRGRLDEQERAACQQVADAVAFAKARARPNGGGPISRPTSGWHQQPKTRF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0843? Email the maintainer — the message is pre-filled with this gene's details.