gcvT Resolved · high auto-curated

H37Rv Rv2211c · MTBC0 - · 379 aa · 2476042–2477181 (-) · RefSeq NP_216727.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)aminomethyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Aminomethyltransferase. Pfam: GCV_T (PF01571.27), GCV_T_C (PF08669.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WN51 SwissProt · reviewed · Evidence at protein level
UniProt nameAminomethyltransferase
EC (curated) EC 2.1.2.10
Curated functionThe glycine cleavage system catalyzes the degradation of glycine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namegcvT
eggNOG descriptionThe glycine cleavage system catalyzes the degradation of glycine
Orthologous groupCOG0404
EC number EC 2.1.2.10
KEGG orthology K00605
KEGG pathways map00260, map00630, map00670, map01100, map01110, map01130, map01200
KEGG modules M00532
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0030312, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.242 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GCV_TPF01571.27 5.7e-7525–277 GCVT N-terminal domain
GCV_T_CPF08669.18 1.8e-16296–374 Glycine cleavage T-protein C-terminal barrel domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gcvH (glycine cleavage system protein H), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1826 gcvH glycine cleavage system protein H 999 1000 ctx cooccurence:774 coexpression:859 experimental:790 database:984 textmining:625
Rv1832 gcvB glycine dehydrogenase 999 1000 ctx fusion:679 cooccurence:743 coexpression:999 database:900 textmining:625
Rv0070c glyA2 serine hydroxymethyltransferase 994 991 ctx fusion:792 coexpression:469 database:900 textmining:450
Rv1093 glyA1 serine hydroxymethyltransferase 994 990 ctx fusion:784 coexpression:475 database:900 textmining:450
Rv0462 lpdC dihydrolipoamide dehydrogenase 976 974 database:955
Rv3356c folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 960 948 coexpression:460 database:900
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 963 938 coexpression:401 database:900 textmining:434
Rv2124c metH methionine synthase 966 935 database:900 textmining:516
Rv0956 purN phosphoribosylglycinamide formyltransferase PurN 955 913 database:900 textmining:510
Rv0389 purT phosphoribosylglycinamide formyltransferase PurT 913 913 database:900
Rv2964 purU formyltetrahydrofolate deformylase 930 909 database:900
Rv1406 fmt methionyl-tRNA formyltransferase 933 906 database:900
Rv2764c thyA thymidylate synthase ThyA 928 905 database:900
Rv2763c dfrA dihydrofolate reductase 925 905 database:900
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 931 903 coexpression:769 database:585

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): aminomethyltransferase
  • Pfam (hmmscan --cut_ga): GCV_T PF01571.27 (E=6e-75), GCV_T_C PF08669.18 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216727.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GCV_T (PF01571.27), GCV_T_C (PF08669.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0404
  • Curated reference: UniProt P9WN51 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 85 functional partner(s); context anchor gcvH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2211c|gcvT
MCQQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTAVGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYVSDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTEMDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLGARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRGLRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVRGRAVECQVVCPPFVAVKTR