Rv1638A Still unknown · low auto-curated

H37Rv Rv1638A · MTBC0 - · 85 aa · 1846716–1846973 (-) · RefSeq YP_177650.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N673 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhage shock protein A

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
T Signal transduction mechanisms
eggNOG descriptionCOG1842 Phage shock protein A (IM30), suppresses sigma54-dependent transcription
Orthologous groupCOG1842

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.328 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2446c (integral membrane protein), high confidence from genomic context alone (score 709 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1639c hyp hypothetical protein 946 947 ctx neighborhood:741 coexpression:802
Rv2468c hyp hypothetical protein 816 812 ctx cooccurence:745
Rv3205c hyp hypothetical protein 737 737 ctx cooccurence:737
Rv2474c hyp hypothetical protein 733 734 ctx cooccurence:732
Rv1083 hyp hypothetical protein 732 733 ctx cooccurence:732
Rv2700 cei hyp hypothetical protein 727 727 ctx cooccurence:727
Rv3605c hyp hypothetical protein 714 714 ctx cooccurence:714
Rv0358 hyp hypothetical protein 709 710 ctx cooccurence:708
Rv2446c integral membrane protein 709 709 ctx cooccurence:709
Rv1109c hyp hypothetical protein 704 704 ctx cooccurence:700
Rv1209 hyp hypothetical protein 705 701 ctx cooccurence:696
Rv2091c membrane protein 697 697 ctx cooccurence:688
Rv2179c 3'-5' exoribonuclease 682 682 ctx cooccurence:681
Rv0948c chorismate mutase 672 673 ctx cooccurence:668
Rv3212 hyp hypothetical protein 668 668 ctx cooccurence:667

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177650.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1842
  • Curated reference: UniProt L7N673 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 92 functional partner(s); context anchor Rv2446c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1638A|
MPDEPTPPEATTPNSESDPRYDSAGVPTFESVREKIETRYGTALGATELDAESPQGRRLEDQYAQRQRAAAERLAQIRESMHTDE