gpm2 Resolved · high auto-curated

H37Rv Rv3214 · MTBC0 - · 203 aa · 3591646–3592257 (+) · RefSeq YP_177944.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphoglycerate mutase
MTBC0 PGAP re-annotation
Revised (this work)Phosphoglycerate mutase. Pfam: His_Phos_1 (PF00300.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q6MWZ7 SwissProt · reviewed · Evidence at protein level
UniProt nameAcid phosphatase
EC (curated) EC 3.1.3.11, EC 3.1.3.2
Curated functionPhosphatase with a broad specificity. Can dephosphorylate a variety of substrates including phosphorylated sugars like fructose-6-phosphate (F6P). Is able to function in vivo as a fructose-1,6-bisphosphatase (FBPase) and to maintain gluconeogenesis when the classical FBPase GlpX is absent. Shows negligible phosphoglycerate mutase activity. Has no phosphatase activity against 3-phosphoglycerate, 2,3-bisphosphoglycerate, or hydrophobic substrates such as alpha-napthyl phosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namegpm2
eggNOG descriptionphosphoglycerate mutase
Orthologous groupCOG0406
EC number EC 3.1.3.73
KEGG orthology K02226
KEGG pathways map00860, map01100
KEGG modules M00122
Gene Ontology (19) GO:0003674, GO:0003824, GO:0003993, GO:0005488, GO:0005515, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0009987, GO:0016311, GO:0016787 +7 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.351 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
His_Phos_1PF00300.28 7.6e-458–191 Histidine phosphatase superfamily (branch 1)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thyA (thymidylate synthase ThyA), high confidence from genomic context alone (score 895 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2764c thyA thymidylate synthase ThyA 895 895 ctx fusion:890
Rv3215 entC isochorismate synthase 888 882 ctx neighborhood:881
Rv3213c SOJ/ParA-like protein 748 748 ctx neighborhood:744
Rv3010c pfkA 6-phosphofructokinase 636 614 database:500
Rv0946c pgi glucose-6-phosphate isomerase 627 571 database:500
Rv0363c fba fructose-bisphosphate aldolase 623 569 database:500
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 528 529 database:500
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 541 521 coexpression:460
Rv2029c pfkB 6-phosphofructokinase PfkB 536 512 database:500
Rv3199c nudC NADH pyrophosphatase 510 510 database:500
Rv2135c hyp hypothetical protein 926 457 ctx cooccurence:452 textmining:870
Rv0255c cobQ1 cobyric acid synthase 457 432 coexpression:413
Rv3837c phosphoglycerate mutase 693 361 textmining:540
Rv2419c gpgP glucosyl-3-phosphoglycerate phosphatase 518 295
Rv0489 gpm1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 525 264

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): phosphoglycerate mutase
  • Pfam (hmmscan --cut_ga): His_Phos_1 PF00300.28 (E=8e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177944.1)
  • Domains: Pfam-A via hmmscan --cut_ga — His_Phos_1 (PF00300.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0406
  • Curated reference: UniProt Q6MWZ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor thyA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3214|gpm2
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGHPQPIAAG