desA3 Resolved · high auto-curated

H37Rv Rv3229c · MTBC0 - · 427 aa · 3605751–3607034 (-) · RefSeq YP_177948.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)stearoyl-CoA 9-desaturase
MTBC0 PGAP re-annotation
Revised (this work)Stearoyl-CoA 9-desaturase. Pfam: FA_desaturase (PF00487.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WNZ3 SwissProt · reviewed · Evidence at protein level
UniProt nameNADPH-dependent stearoyl-CoA 9-desaturase
EC (curated) EC 1.14.19.n4
Curated functionIs likely involved in the aerobic desaturation system responsible for the synthesis of oleic acid from stearoyl-CoA; oleic acid is a precursor of mycobacterial membrane phospholipids and triglycerides. Catalyzes the conversion of stearoyl-CoA to oleoyl-CoA by introduction of a cis double bond between carbons 9 and 10 of the acyl chain. Requires the electron transfer partner Rv3230c to pass two electrons from NADPH to its active site diiron center. Is also able to catalyze the 9-desaturation of palmitoyl-CoA to palmitoleoyl-CoA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namedesA3
eggNOG descriptionfatty acid desaturase
Orthologous groupCOG3239
EC number EC 1.14.19.3
KEGG orthology K00508
KEGG pathways map00591, map01100
Gene Ontology (39) GO:0001676, GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006633, GO:0008150, GO:0008152 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.234 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FA_desaturasePF00487.31 8.4e-3469–339 Fatty acid desaturase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3230c (stearoyl-CoA 9-desaturase electron transfer protein), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3230c stearoyl-CoA 9-desaturase electron transfer protein 999 1000 ctx neighborhood:788 fusion:794 cooccurence:766 coexpression:824 database:900 textmining:700
Rv0824c desA1 acyl-ACP desaturase DesA 974 924 database:900 textmining:679
Rv1094 desA2 acyl-ACP desaturase DesA 987 923 database:900 textmining:838
Rv3231c hyp hypothetical protein 710 710 ctx neighborhood:709
Rv3234c tgs3 diacyglycerol O-acyltransferase 536 526 ctx neighborhood:435
Rv0241c htdX 3-hydroxyacyl-thioester dehydratase HtdX 527 526 ctx cooccurence:515
Rv3233c Rv3233c, (MTCY20B11.08c), len: 196 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to C-terminus of Q9RIU8|SCM11.13 522 512 ctx neighborhood:435
Rv2777c hyp hypothetical protein 508 509 ctx cooccurence:493
Rv3232c ppk2 polyphosphate kinase 455 451 ctx neighborhood:448
Rv0242c fabG4 3-oxoacyl-ACP reductase FabG 460 439 ctx cooccurence:402
Rv3252c alkB transmembrane alkane 1-monooxygenase AlkB 438 439 ctx cooccurence:435
Rv0243 fadA2 acetyl-CoA acetyltransferase FadA 546 435 ctx cooccurence:419
Rv1814 erg3 membrane-bound C-5 sterol desaturase 578 298 textmining:425
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 444 298
Rv2524c fas fatty acid synthase 477 208

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): stearoyl-CoA 9-desaturase
  • Pfam (hmmscan --cut_ga): FA_desaturase PF00487.31 (E=8e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177948.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FA_desaturase (PF00487.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3239
  • Curated reference: UniProt P9WNZ3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv3230c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3229c|desA3
MAITDVDVFAHLTDADIENLAAELDAIRRDVEESRGERDARYIRRTIAAQRALEVSGRLLLAGSSRRLAWWTGALTLGVAKIIENMEIGHNVMHGQWDWMNDPEIHSSTWEWDMSGSSKHWRYTHNFVHHKYTNILGMDDDVGYGMLRVTRDQRWKRYNIFNVVWNTILAIGFEWGVALQHLEIGKIFKGRADREAAKTRLREFSAKAGRQVFKDYVAFPALTSLSPGATYRSTLTANVVANVIRNVWSNAVIFCGHFPDGAEKFTKTDMIGEPKGQWYLRQMLGSANFNAGPALRFMSGNLCHQIEHHLYPDLPSNRLHEISVRVREVCDRYDLPYTTGSFLVQYGKTWRTLAKLSLPDKYLRDNADDAPETRSERMFAGLGPGFAGADPVTGRRRGLKTAIAAVRGRRRSKRMAKSVTEPDDLAA