Rv3218 Family assigned · medium auto-curated

H37Rv Rv3218 · MTBC0 mtbc0_003424 · 321 aa · 3616610–3617575 (+) · RefSeq NP_217734.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationdiacylglycerol kinase family lipid kinase
Revised (this work)Diacylglycerol kinase family lipid kinase. Pfam: DAGK_cat (PF00781.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05848 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptiondiacylglycerol kinase, catalytic
Orthologous groupCOG1597

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.264 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DAGK_catPF00781.30 2.2e-242–119 Diacylglycerol kinase catalytic domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3217c (integral membrane protein), high confidence from genomic context alone (score 748 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3217c integral membrane protein 747 748 ctx neighborhood:748
Rv3219 whiB1 transcriptional regulator WhiB1 869 722 ctx neighborhood:720 textmining:550
Rv0440 groEL2 molecular chaperone GroEL 626 622 database:608
Rv3417c groEL1 chaperonin GroEL 625 621 database:608
Rv0814c sseC2 hyp hypothetical protein 482 483 ctx cooccurence:482
Rv3118 sseC1 hyp hypothetical protein 482 482 ctx cooccurence:482
Rv1023 eno enolase 446 446 coexpression:446
Rv2844 hyp hypothetical protein 425 426 ctx cooccurence:422
Rv3231c hyp hypothetical protein 421 422 ctx cooccurence:420
Rv3752c tadA cytidine/deoxycytidylate deaminase 415 77
Rv1592c hyp hypothetical protein 619 47 textmining:617
Rv0022c whiB5 transcriptional regulator WhiB5 512 41 textmining:512

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: diacylglycerol kinase family lipid kinase
  • Pfam (hmmscan --cut_ga): DAGK_cat PF00781.30 (E=2e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217734.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DAGK_cat (PF00781.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1597
  • Curated reference: UniProt O05848 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv3217c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003424|Rv3218|
MRAVLIVNPTATATTPAGRDLLAHALESRLQLTVEHTNHRGHGTELGQAAVADGVDLVVVHGGDGTVSAVVNGMLGRPGTTPVRPVPAVAVVPGGSANVLARALGISADPIAATNQLIQLLDDYGRHQQWRRIGLIDCGERWAVFNAGMGVDAEVVAAVEAERDKGGKVTAWRYIRAAVRAVLACTRREPALTLQLPNRDPITGVHFVFVSNSSPWTYANNRPVWTNPDCRFESGLGVFATTSMKVVPTLRVVRQMFAKQPKFEFNHVINNDDVACLRVTSMGPPIASQFDGDYLGVRETMTFRAVPDALAVVAPPARKRI