Rv1025 Still unknown · low auto-curated

H37Rv Rv1025 · MTBC0 - · 155 aa · 1146561–1147028 (+) · RefSeq NP_215541.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF501. Function unknown. Foldseek best (non-significant) hit: 4xku-assembly1_A E coli BFR variant Y114F (prob 0.01, TM 0.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P96375 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF501)
Orthologous groupCOG1507
KEGG orthology K09009

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.581 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF501PF04417.18 1.3e-3617–136 Protein of unknown function (DUF501)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 86.8 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4xku-assembly1_A 0.01 0.19 7.7e+00 4xku-assembly1_A E coli BFR variant Y114F

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1024 (membrane protein), high confidence from genomic context alone (score 885 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1026 ppx2 hyp hypothetical protein 993 993 ctx neighborhood:881 fusion:899 coexpression:500
Rv1024 membrane protein 885 885 ctx neighborhood:861
Rv1023 eno enolase 876 877 ctx neighborhood:861
Rv1022 lpqU lipoprotein LpqU 763 763 ctx neighborhood:762
Rv1021 mazG nucleoside triphosphate pyrophosphohydrolase 686 687 ctx neighborhood:682
Rv3219 whiB1 transcriptional regulator WhiB1 656 656 ctx cooccurence:656
Rv3260c whiB2 transcriptional regulator WhiB2 622 622 ctx cooccurence:620
Rv1020 mfd transcription-repair coupling factor 620 620 ctx neighborhood:610
Rv1830 HTH-type transcriptional regulator 619 619 ctx cooccurence:594
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 594 595 ctx cooccurence:591
Rv3195 hyp hypothetical protein 702 585 ctx cooccurence:583
Rv1321 nucS endonuclease NucS 532 532 ctx cooccurence:530
Rv0807 hyp hypothetical protein 505 505 ctx cooccurence:503
Rv1440 secG protein-export membrane protein SecG 491 491 ctx cooccurence:458
Rv0004 hyp hypothetical protein 477 477 ctx cooccurence:474

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF501 PF04417.18 (E=1e-36)
  • Foldseek best: 4xku-assembly1_A E coli BFR variant Y114F (prob 0.01, E=8e+00, TM=0.19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215541.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF501 (PF04417.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1507
  • Curated reference: UniProt P96375 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 86.8, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor Rv1024
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1025|
MVTRQLGRAPRGVLAIAYRCPNGEPGVVKTAPRLPDGTPFPTLYYLTHPVLTAAASRLETTGLMREMNRRLGQDAELAAAYRRAHESYLSERDALEPLGTTVSAGGMPDRVKCLHVLIAHSLAKGPGLNPFGDEALALLAAEPRTAATLVAGQWR