Rv3207c Still unknown · low auto-curated

H37Rv Rv3207c · MTBC0 - · 285 aa · 3583801–3584658 (-) · RefSeq NP_217723.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3152. Function unknown. Foldseek best (non-significant) hit: 6n8l-assembly1_T Cryo-EM structure of early cytoplasmic-late (ECL) pre (prob 0.09, TM 0.41).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O05859 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionZinc-dependent metalloprotease
Orthologous groupCOG5479

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.442 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3152PF11350.15 1.4e-10473–283 Protein of unknown function (DUF3152)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 90.2 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6n8l-assembly1_T 0.09 0.41 9.3e+00 6n8l-assembly1_T Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit
6hiw-assembly1_CI 0.01 0.19 5.6e+00 6hiw-assembly1_CI Cryo-EM structure of the Trypanosoma brucei mitochondrial ribosome - This entry contains the complete small mitoribosomal subunit in complex with mt-IF-3

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1417 (membrane protein), medium confidence from genomic context alone (score 696 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3205c hyp hypothetical protein 749 749 ctx neighborhood:589 cooccurence:413
Rv1417 membrane protein 707 696 ctx cooccurence:692
Rv1698 mctB copper transporter MctB 691 692 ctx cooccurence:684
Rv3669 transmembrane protein 691 691 ctx cooccurence:691
Rv1083 hyp hypothetical protein 645 646 ctx cooccurence:644
Rv2980 hyp hypothetical protein 637 637 ctx cooccurence:637
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 600 600 ctx neighborhood:594
Rv3311 hyp hypothetical protein 599 600 ctx cooccurence:594
Rv0358 hyp hypothetical protein 589 589 ctx cooccurence:589
Rv1222 rseA anti-sigma E factor RseA 579 579 ctx cooccurence:574
Rv2520c membrane protein 570 570 ctx cooccurence:570
Rv3217c integral membrane protein 562 562 ctx cooccurence:560
Rv0556 transmembrane protein 553 554 ctx cooccurence:547
Rv1109c hyp hypothetical protein 525 526 ctx cooccurence:510
Rv3212 hyp hypothetical protein 511 512

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF3152 PF11350.15 (E=1e-104)
  • Foldseek best: 6n8l-assembly1_T Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribos (prob 0.09, E=9e+00, TM=0.41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217723.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3152 (PF11350.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5479
  • Curated reference: UniProt O05859 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 90.2, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor Rv1417
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3207c|
MSTYGWRAYALPVLMVLTTVVVYQTVTGTSTPRPAAAQTVRDSPAIGVVGTAILDAPPRGLAVFDANLPAGTLPDGGPFTEAGDKTWRVVPGTTPQVGQGTVKVFRYTVEIENGLDPTMYGGDNAFAQMVDQTLTNPKGWTHNPQFAFVRIDSGKPDFRISLVSPTTVRGGCGYEFRLETSCYNPSFGGMDRQSRVFINEARWVRGAVPFEGDVGSYRQYVINHEVGHAIGYLRHEPCDQQGGLAPVMMQQTFSTSNDDAAKFDPDFVKADGKTCRFNPWPYPIP